(data stored in ACNUC7421 zone)

EMBL: CP000462.PE474

CP000462.PE474       Location/Qualifiers
FT   CDS_pept        531920..532378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0498"
FT                   /product="Pab N-terminal acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36874"
FT                   /db_xref="GOA:A0KFK5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK5"
FT                   /protein_id="ABK36874.1"
FT                   /translation="MLTVRAARTDDLGAIVKLERYCFPPEVAFGRSRWHYLLTHAKGRT
FT                   LLVLDQQEQLMGYLCLLEHRGWDRLIIQTLAIRWTIRRQGWARRLLEQVIQEGKEAGWG
FT                   AIRLEVGDANEEAQALYRELGFRPRQKLLDYYGHGQHAHRLVLALKQA"
     gtgttgaccg tgcgcgcggc ccggaccgat gatctgggcg ccatcgttaa gctggaacgc        60
     tactgttttc cccccgaagt cgcctttggc cgcagccgct ggcactatct gctgacccac       120
     gccaaggggc gtaccctgct ggtgctggac cagcaggagc agctgatggg ctacctctgt       180
     ctgctggagc acaggggctg ggatcggctg atcatccaga ccctcgccat tcgctggacc       240
     atccgccggc aaggctgggc ccgccgcctg ctggagcagg tgatccagga aggcaaagag       300
     gccggctggg gggcgatccg gctggaggtc ggcgatgcca atgaagaggc gcaggccctc       360
     tatcgcgagc tgggttttcg gcccagacag aagctgctgg actattatgg ccacggtcag       420
     cacgcccacc ggctggtact ggcgctgaag caggcctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page