(data stored in ACNUC7421 zone)

EMBL: CP000462.PE475

CP000462.PE475       Location/Qualifiers
FT   CDS_pept        532393..532638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36552"
FT                   /db_xref="GOA:A0KFK6"
FT                   /db_xref="InterPro:IPR022072"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK6"
FT                   /protein_id="ABK36552.1"
FT                   /translation="MSCDNCLATAIKAKLGRCPVCAGQTFVIGLVGWLVWWWCGADTSV
FT                   NALTGLLFALGGSGLLLLHLLVFVWRRATGRELSDE"
     atgagctgcg acaactgcct cgccaccgcc atcaaggcca agctggggcg ctgcccggtc        60
     tgcgccggcc agaccttcgt catcggtctg gtcggctggc tggtctggtg gtggtgtggc       120
     gccgacacct cggtcaacgc cctcaccggc ctgctgttcg cgctgggggg atcgggcctg       180
     ttgctgctcc acctgctggt gtttgtctgg cgcagggcga ccggacgtga attgagcgat       240
     gaataa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page