(data stored in ACNUC7421 zone)

EMBL: CP000462.PE476

CP000462.PE476       Location/Qualifiers
FT   CDS_pept        532695..533441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0500"
FT                   /product="NADP-dependent l-serine/l-allo-threonine
FT                   dehydrogenase ydfg"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35974"
FT                   /db_xref="GOA:A0KFK7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK7"
FT                   /protein_id="ABK35974.1"
FT                   /translation="MIAMVTGASSGFGESISRQLVQAGYRVIGTGRRGERLAALADELG
FT                   AQFLPLVFDVQDKAATRAAIDGLPAEWREVDLLVNNAGLALGLEPAHKADLEDWEQMIA
FT                   TNISGLTLLTRLLLPGMVARNRGHVINIGSIAGTYPYPGGNVYGATKAFVKQFSLNLRA
FT                   DLAGTAIRVTNVEPGLCGGTEFSNVRFHGDDAKAATVYQGVQAIQPEDIANTVLWISQQ
FT                   PAHVNINSIEIMPVAQTFGPLNISRR"
     atgatagcaa tggtaacggg cgcctcgtcc gggtttggtg agtccatcag ccgtcagctg        60
     gtgcaggcgg gctaccgggt gatcggcacc ggccgccgcg gcgaacggct ggcggcgctg       120
     gccgacgagc tgggcgcgca gttcctgccg ctggtgttcg acgtgcagga caaggcggcc       180
     acccgcgccg ccatcgatgg gctgccggcc gagtggcgcg aggtggatct gctggtcaac       240
     aacgccgggc tggcgctggg gctggagccg gcccacaagg cggatctgga agactgggag       300
     cagatgatcg ccaccaacat cagcggcctg accctgctca cccgcctgct gctgccgggg       360
     atggtggcgc gcaatcgcgg ccacgtcatc aacatcggct ccatcgccgg cacctacccc       420
     tatccgggcg gcaacgtcta cggcgccacc aaggcgttcg tgaagcagtt cagcctcaac       480
     ctgcgtgccg atctggcggg caccgccatc cgcgtcacca acgtggagcc gggcctgtgc       540
     ggcggcaccg agttctccaa cgtgcgcttt cacggtgacg atgccaaggc ggccaccgtg       600
     tatcagggcg tgcaggcgat ccagccggaa gacatcgcca ataccgtgct ctggatcagc       660
     cagcagccgg cccacgtcaa catcaacagc atcgagatca tgccggtggc gcagaccttc       720
     ggcccgctca atatcagccg tcgctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page