(data stored in ACNUC7421 zone)

EMBL: CP000462.PE48

CP000462.PE48        Location/Qualifiers
FT   CDS_pept        54250..55437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0052"
FT                   /product="trans-2-enoyl-CoA reductase"
FT                   /EC_number="1.3.1.44"
FT                   /note="identified by match to protein family HMM PF07055"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37443"
FT                   /db_xref="GOA:A0KEB7"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB7"
FT                   /protein_id="ABK37443.1"
FT                   /translation="MIIHPQIQGCVARNCHPIGCRAAVLQQIASVRAAGSFNGPKRVLV
FT                   LGASSGFGLASRIALTFGAGADTVGVSFERGPSDKGPGSAGWYNNIWFRKEAEQTGRIA
FT                   INLIGDAFSIGMRQQAIDTIRQQLGQVDLVIYSLASGIRVLPDGTQVRSVLKTTSQPFS
FT                   GWGLDLEHDTLVQQSLDPATPEEIRDTVSVMGGEDWQLWLQALQQADCLAPGAQTVAYS
FT                   YIGPESTYPLYRDGTIGYAKEHLHATAETINLQLAELGGHAWVSVCKALVTKASAYIPV
FT                   LPVYLGLLMGVMKERGVHEGCIEQMQRLFATKMYGPQGVVADGNRLIRMDDHELDPAIQ
FT                   AAVSALWSKVTPDNFHALGDFAGLRQDFMQLNGFELPGVDYGAPVDLASLTELLP"
     atgatcattc acccacagat ccagggctgc gtcgcccgca actgtcaccc catcggctgc        60
     cgcgccgccg tgttgcaaca gattgccagc gtcagggcgg cgggctcctt caacgggccg       120
     aaacgggtgc tggtgctggg cgcttcgtcc ggcttcgggc tggcgtcgcg cattgccctg       180
     accttcggag ccggggccga caccgtcggc gtgtcgttcg agcggggccc ttctgacaag       240
     gggccgggca gcgccggttg gtacaacaac atctggtttc gcaaggaggc ggagcagacc       300
     ggccgcattg ccatcaatct gatcggggat gccttctcca tcgggatgcg ccagcaggcc       360
     atcgacacta tccgccagca gctggggcag gtggatctgg tgatctactc gctggcgagc       420
     ggcatccggg tgttgcctga cggcacgcaa gtgcgctccg tgctcaagac caccagccag       480
     ccattcagcg gctgggggct ggatctggaa cacgacaccc tggtgcagca gtctctggat       540
     ccggccaccc cggaggagat ccgcgacacc gtcagcgtga tgggcggcga ggattggcag       600
     ctctggctgc aggcgttgca gcaggcggat tgcctcgcgc ccggcgccca gaccgtggcc       660
     tactcctata tcggccccga atcgacctac cccctctatc gggacggcac catcggttat       720
     gccaaggagc atctgcacgc caccgccgag accatcaacc tgcagctggc ggagcttggc       780
     ggccatgcct gggtgtcggt ctgcaaggcg ctggtgacca aggcgagcgc ctatattccg       840
     gtgctgccgg tctatctggg cctgctgatg ggggtgatga aggagcgcgg cgtgcacgaa       900
     ggctgcatcg agcagatgca gcggctgttc gccaccaaga tgtacggccc gcaaggggtg       960
     gtggccgacg gcaaccggct gatccggatg gatgaccacg aactggaccc ggccattcag      1020
     gccgccgtct cggcgctctg gtccaaggtg acgccggaca acttccacgc gctgggggac      1080
     tttgccgggt tgcgccagga cttcatgcag ctcaacggct tcgagctgcc gggcgtcgac      1140
     tacggcgcgc cggtggatct ggcctcgctg accgagctgc tgccctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page