(data stored in ACNUC7421 zone)

EMBL: CP000462.PE480

CP000462.PE480       Location/Qualifiers
FT   CDS_pept        536885..538060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0504"
FT                   /product="NADH-dependent iron-containing alcohol
FT                   dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38651"
FT                   /db_xref="GOA:A0KFL1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL1"
FT                   /protein_id="ABK38651.1"
FT                   /translation="MHSTEGSAVYNFQYANPTRVCFGEGQIAKLPELIPAGSRLLVLYG
FT                   GGSIKQNGVYEQLTQALAGREWLEFPGIGANPQYDQLMEAVALVKRERIDFLLAVGGGS
FT                   VVDGSKFVAAAACFEGADPWEILLHKAPIKAALPLGCVLTLPATGSESNPAAVVSRGEA
FT                   KLSFMNPLVQPVFAVLDPTTTYSLPPRQVGNGVVDAFVHIIEQYLTFPVGGEVQDRLAE
FT                   GLLQVLVDNGPRALAEPTNYQVRANLMWAASLALNGLIGRGVPQDWSTHAIGHQLTALH
FT                   GLDHAQSLAVVLPSLLREQSGQKQEKLAQFAERVWHSSREDKALRIEEAIIRTEQFFQQ
FT                   MGVGTRLADYGLSESCIPGICSNLKRFGLTALGEQQDIDPDKVARILSHAL"
     atgcattcaa ccgagggctc tgccgtgtac aacttccaat atgccaatcc tacccgcgtc        60
     tgtttcggtg aaggccagat cgccaagctg cccgaactga tcccggccgg cagccgcctg       120
     ctggtgctct acggcggcgg cagcatcaaa cagaacgggg tctatgagca gttgacccag       180
     gcgctggcgg gacgggagtg gctggagttt cccggcatcg gcgccaaccc ccagtacgat       240
     cagctgatgg aggcggtagc cctggtcaag cgcgagcgca tcgacttcct gctggcggtc       300
     ggcggtggtt ccgtggtgga tggcagcaag ttcgtggctg ccgcggcctg cttcgagggg       360
     gcggatccct gggagatcct gctgcacaag gcccccatca aggcagcact gccgctgggc       420
     tgcgtgctga ccctgccggc caccggctcg gagagcaacc cggccgccgt ggtgagccgc       480
     ggggaggcca agctctcctt catgaaccca ttggtgcagc cggtgtttgc ggtgctggat       540
     cccacgacca cctacagcct gccgccgcgc caggtaggca acggggtggt ggatgccttc       600
     gtccacatca tcgagcagta cctcaccttc ccggtggggg gcgaggtgca ggaccggctg       660
     gcggaagggc tgctgcaggt gctggtggac aacggcccgc gagcgctggc ggagcccacc       720
     aactatcagg tgcgcgccaa tctgatgtgg gcggccagcc tggcgctcaa cggcctcatc       780
     ggtcgcggcg tgccgcagga ctggtccacc cacgccatcg gtcaccagct caccgccctg       840
     cacgggctgg atcatgccca gagtctggcg gtggtgctgc cctcgctgct gcgggaacaa       900
     tcggggcaga agcaggagaa gctggcccag ttcgccgagc gggtatggca ctccagccgc       960
     gaggacaagg cgctgcgcat cgaggaggcg attatccgca ccgagcagtt cttccagcag      1020
     atgggggtgg gcacccggct cgccgactac ggcctgagcg agagctgcat ccccggcatc      1080
     tgctccaacc tcaagcgttt cgggctgacc gccctcgggg agcagcagga catagatccg      1140
     gacaaggtag ccaggatcct gtcccacgcg ctttaa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page