(data stored in ACNUC7421 zone)

EMBL: CP000462.PE482

CP000462.PE482       Location/Qualifiers
FT   CDS_pept        complement(539003..540271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0506"
FT                   /product="O-acetylhomoserine sulfhydrylase MetY"
FT                   /EC_number="2.5.1.49"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01053; match to protein
FT                   family HMM PF01212; match to protein family HMM TIGR01326"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37755"
FT                   /db_xref="GOA:A0KFL3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL3"
FT                   /protein_id="ABK37755.1"
FT                   /translation="MKDATLALHHGFTSDPTTKAVAVPIYQTVAYEFESAQHGADLFNL
FT                   AVPGNIYTRIMNPTNDVLEQRMAALEGGIAGLVVSAGSAAITYAIQALTAAGDNIVSTP
FT                   QLYGGTYTLFAHMLPSFGVEVRFAKDDSAEAIAALIDDKTKAVYCESIGNPAGNIVDLA
FT                   AFAKVAHARGVPLIVDNTVATPVLCKPIEHGADIVVHSLTKYVGGHGNSLGGVIVDSGK
FT                   FPWADHAERFPQLTKPEPSYHGVVYTEAFGPAAFIGRVRTVPLRNTGAALAPMNAFLLL
FT                   QGLETLSLRMERHVDNALRVAHHLKHHPKVAWVSYAGLPGHPHYLLAEKYMAGRPSAIL
FT                   SFGLKDGYEAGVRFYDALKIFKRLVNIGDAKSLACHPASTTHRQLSEAEQAKAGVKPEM
FT                   IRLSVGIEAIEDILADLDQALEA"
     atgaaagatg cgaccctggc cctgcaccac ggctttacca gcgaccccac caccaaggcc        60
     gttgccgtgc ccatctacca gacggtggcc tacgagttcg agagcgccca gcacggggcg       120
     gatctgttca atctggcggt accaggcaac atctacaccc gcatcatgaa ccccaccaac       180
     gatgtgctgg agcaacggat ggccgcgctg gaagggggca tcgccggcct ggtggtctcg       240
     gcgggttccg ccgccatcac ctacgccatc caggcgctga ccgcagccgg tgacaacatc       300
     gtctccacac cccagctcta tggcggcacc tacacattgt tcgcccacat gctgccgagt       360
     ttcggggtcg aggtgcgctt cgccaaggat gacagtgccg aggccatcgc cgccctcatc       420
     gacgacaaga ccaaggcggt ctactgcgag agcataggca acccggccgg caacatcgtc       480
     gatctggcgg ccttcgccaa ggtggcccac gcccgcggcg tgccgctcat cgtcgacaac       540
     acggtcgcca ccccggtgct gtgcaaaccc atcgaacacg gcgccgacat cgtcgtccac       600
     agcctgacca aatatgtcgg cggccacggc aactcgctgg gtggcgtcat cgtcgactcg       660
     ggcaagttcc cctgggcgga tcacgccgag cgcttccccc agctgaccaa acccgagcct       720
     tcttatcacg gggtggtcta caccgaggcc tttggcccgg ccgccttcat cggccgggtg       780
     cgcaccgtgc cgctgcgcaa taccggcgcc gcactggcgc cgatgaacgc cttcctgctg       840
     ctgcaggggc tggagaccct gagcctgcgc atggagcgcc acgtggacaa cgccctgcgg       900
     gtggcccacc acctcaagca ccaccccaag gtggcatggg tcagctacgc cggtctgccg       960
     ggtcaccccc actacctgct ggcggagaaa tacatggctg gccgcccctc ggccatcctc      1020
     tcgttcgggc tgaaggatgg ctacgaggcc ggcgtgcgct tctacgatgc gctcaagatc      1080
     ttcaagcggc tggtcaacat cggcgatgcc aagtcgctgg cctgccaccc cgcctccacc      1140
     acccatcgcc agttgagcga ggcggagcag gccaaagccg gcgtgaaacc tgagatgatc      1200
     cggctgtcgg tggggatcga ggccatcgag gacattctgg cggatctgga tcaggcgctg      1260
     gaggcctga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page