(data stored in ACNUC7421 zone)

EMBL: CP000462.PE484

CP000462.PE484       Location/Qualifiers
FT   CDS_pept        540675..542438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0508"
FT                   /product="bacterial extracellular solute-binding proteins,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37974"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL5"
FT                   /protein_id="ABK37974.1"
FT                   /translation="MTFSNRISPFMPTSRLYQQFQRLAQQLGCDEREISLAEVADLLCC
FT                   TPRNARLLLRRMQDQGWLSWAAEAGRGRRSRLTLLDNQESLTRRRLRDLLSQGQLAQAV
FT                   RLAEDRLDLLTPLLIEQLGQATREGRQILRVPYYRPLPRLLPTGPLRRSEIHLSRQIFN
FT                   GLTRRNEENGEIEGDLAHHWECLGPCHWRFYLRPAVRFHHGRELVVEDVVESLLALRDR
FT                   PLFAHLARLESPWPRTLDLHLDSPDPLLPQLLAEPVAAILPRELKEEAGFALQPVGTGP
FT                   YRVTANDPLQLCLEAFDDYFGLRALLDEIDIWMLPELAERLESHLQLGRDSPELGTMRG
FT                   ESELESGCYFLLQDDRSASLQDPALRQWLAGLLNPIALMARVAPELQRGWTSALGLLPH
FT                   WREAQPAPLPMPEQLPRQLVLACFNQHLEFNECANAMSSLLAEQGIRLEVRTLDYGRWV
FT                   SGVDEDVDLWLGTLNLEHEHAFAPYAWLQGTPLLRKVWGSQQRLWQGLTQWRASGEEPG
FT                   PRALLASVQQQGWFVPLFHHWLELESRVGVHGVRMTALGWFDFRSAWLRPELAVGGGDT
FT                   TGELESKGGPR"
     atgactttca gcaacaggat ttcccctttt atgcccacca gtcgcctcta ccagcaattc        60
     caacggctcg cccagcagct tggctgcgac gagcgggaga tcagcctcgc cgaggtagcg       120
     gatctgctct gctgcacccc gcgcaacgct cgcctgctgc tgcgccgcat gcaggatcag       180
     ggctggctca gctgggcggc agaagccggg cgggggcggc gctcccggct caccctgctc       240
     gacaaccagg agagcctgac ccggcgccgg ctgcgggatc tgctcagcca gggccagctg       300
     gcgcaggcgg tgcggctggc cgaagatcgc ctcgatctgc tcaccccgct gctgatcgag       360
     cagctcggcc aggctacccg ggaagggcgc cagatcctgc gggtgcccta ctaccggccg       420
     ctgccgcgcc tgctgcccac cggcccgctg cgtcgctccg aaatccacct gagccgccag       480
     atcttcaatg gcctgactcg gcgaaatgag gaaaatgggg aaatcgaggg ggatctggcc       540
     caccactggg agtgtctggg cccctgccac tggcgcttct acctgaggcc ggcggtgcgt       600
     tttcaccacg gccgcgagct ggtggtggag gatgtggtgg agagcctgct ggccctgcgg       660
     gatcgcccgc tgtttgccca tctggcgcgg ctggagagcc cctggccgcg caccctggat       720
     cttcatctcg acagcccgga tcctctgctg ccccagctgc tggccgagcc ggtggcggcc       780
     atcctgccgc gcgagctcaa ggaggaggcg ggctttgccc tgcagccggt aggcacaggc       840
     ccctaccggg tgaccgccaa cgacccgctg caactgtgcc tcgaggcatt cgacgactac       900
     ttcggcctgc gggccctgct cgacgagatc gacatctgga tgctgccgga gctggcggag       960
     cggctggaga gccacctgca gctggggcgc gacagccccg aactcggcac catgcgcggc      1020
     gagtccgagc tggaatccgg ctgctacttc ctgctgcagg acgacagatc cgcatccttg      1080
     caggatcccg ccctgcgcca gtggctggcc ggcctgctca accccatcgc cctgatggcg      1140
     cgggtcgccc ccgagctgca gcggggctgg accagcgcgc tcggtctctt gccccactgg      1200
     cgcgaggcgc agccggcccc gctgccgatg ccggaacaac tgccgcgcca gctggtgctg      1260
     gcctgcttca accagcacct ggaattcaac gagtgcgcca acgccatgag cagcctgctg      1320
     gcagagcagg ggatccggct cgaggtgcgc accctggatt acggccgctg ggtaagcggg      1380
     gtggacgagg atgtggatct ctggctcggc accctcaacc tggagcacga acacgccttc      1440
     gccccctacg cctggttgca gggcaccccg ctgctgcgca aggtgtgggg cagccagcaa      1500
     cgtctgtggc aggggctgac gcagtggcgt gccagcggcg aggagccggg gccgcgcgcc      1560
     ctgctggcaa gcgtgcagca gcagggctgg ttcgtgccgc tgtttcacca ctggctggag      1620
     ctggagagcc gggtcggcgt gcacggggta cggatgacgg cgctcggctg gttcgatttt      1680
     cgcagcgcct ggctgcgccc ggagctggcc gtcggcggcg gcgatacgac gggggagctt      1740
     gagtccaaag gcgggccgcg ttag                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page