(data stored in ACNUC7421 zone)

EMBL: CP000462.PE485

CP000462.PE485       Location/Qualifiers
FT   CDS_pept        542474..542869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0509"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37087"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFL6"
FT                   /protein_id="ABK37087.1"
FT                   /translation="MLEMQIQPRFQETDALGHINNTVPAVWFESARDPLFRIFSPELDV
FT                   HNWHLIIAGYTVQFKRELFYGQQVLIKTGVRRIGSSSFTLWQEAWQGDELAVTAETTLI
FT                   HFDYQSRQSIPLSDRHREGLRAWLIES"
     atgctggaaa tgcagatcca accccgtttt caagagacag atgccctcgg ccacatcaac        60
     aacacggtgc cggcggtctg gtttgaatcg gcccgcgacc cgctgtttcg catcttctcc       120
     cccgagctgg atgtgcacaa ctggcatctg atcatcgcgg gctacacggt gcagttcaaa       180
     cgggagctgt tctacggcca gcaggtattg atcaaaaccg gggtccgccg catcggctcc       240
     agctccttca cgctctggca ggaagcctgg cagggggacg agctggcggt gaccgccgaa       300
     accaccctga tccattttga ctaccagtcc cgccagtcca ttcccctgag cgatcgccac       360
     cgggaggggc tgcgggcctg gctgatagaa agctaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page