(data stored in ACNUC7421 zone)

EMBL: CP000462.PE49

CP000462.PE49        Location/Qualifiers
FT   CDS_pept        complement(55453..57243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0053"
FT                   /product="tetratricopeptide repeat family"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM PF07721; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37133"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB8"
FT                   /protein_id="ABK37133.1"
FT                   /translation="MALALLWMTQLQATPSLLKEAELQAARDPVGYLQRLDANPQQDME
FT                   QFYARALAQAALGRYPQALLDNARARGLASAQQETLRLLDFRLQQIALTLDTEAPDQAL
FT                   TLLEQLKPAVAGHPQQTSEWHALNGLALYRTQQLSAAIAELKTAFRLKQTIPDSTLASL
FT                   QCARLLMTLGNLYADLNLAREAESYYLEALQRMVQLDEPNSQTIIRANMARLYIDTDRP
FT                   AQARRLLDNLLSNPALAPDYRAIILGYQAMALNAERDWAGALRALDEAQALYQQLGYPE
FT                   AGVRLLETRARALQGSGEKQLALQLLTSQGPAGAGSKALQASLLADQGRYPEAYQALNE
FT                   YVNDYKQHFNQTLSQHASAFQAEMDLARSEASNRVLQQENENKRQQLLHQQSARHYQLA
FT                   LVGLLASALLLLGVTTHRLHRSSRHLYKLATFDQLTELPNRRALLERLATQWQQEGPLT
FT                   LLIIDIDHFKQINDRHGHQAGDRAIQRLARELRSWAPDLQLVGRWGGEEFLVAVPLPAA
FT                   DCWYLAEQLRQRIGQIDKPRMTISIGVAGRSAADDGLGQLIHRADMAMYQAKRQGRNQT
FT                   ILAAEPLNPEQPEALASSVA"
     atggcactgg cgctgctctg gatgacccag ctgcaggcca ctccctcctt gctgaaagag        60
     gctgaactgc aggcggcgcg cgatcccgtc ggctatctgc aacgcctcga cgccaacccg       120
     cagcaggaca tggagcagtt ttacgccaga gccctggccc aggccgcgct ggggcgctat       180
     ccgcaagccc tgctcgacaa cgcccgtgcc cgcgggctgg ccagtgccca gcaggagacc       240
     ctgcgtctgc tcgacttccg cttgcagcag atcgccctca ccctggatac cgaagcgccg       300
     gatcaggcgc tcaccctgct ggagcagctc aaacccgccg tcgccggtca tccgcagcag       360
     acctcggagt ggcacgccct caacgggctc gcgctctatc gcacccagca gctcagtgcg       420
     gcgatcgccg agctcaagac cgcctttcgc ctcaagcaga cgatacctga ctccaccctc       480
     gccagtctgc agtgcgcccg cctgctgatg accctcggca acctctatgc cgacctcaat       540
     ctggcgcggg aggccgaaag ctattacctg gaggcgctgc agcgcatggt gcagctggac       600
     gagcccaaca gccagaccat catccgggcc aacatggcgc ggctctatat cgataccgat       660
     cgccccgccc aggccagacg gctgctggac aacctgctca gcaacccggc gctggcgccg       720
     gactaccgtg ccatcatcct cggctatcag gccatggcgc tcaatgccga gcgcgactgg       780
     gccggcgccc tgcgcgcact ggacgaggca caggcgctct atcagcaact gggctacccg       840
     gaagccgggg tgcgtctgct ggagacccgg gccagggcac tgcagggcag cggcgagaag       900
     cagctggcgc tgcaactgct gaccagccag gggcctgccg gtgccggcag caaggccttg       960
     caggccagcc tgctggcgga tcaggggcgc tatcccgagg cctaccaggc gctcaatgaa      1020
     tacgtgaacg actacaagca gcacttcaac cagaccctga gccagcatgc ctccgccttc      1080
     caggccgaga tggatctggc ccgcagcgag gccagcaacc gggtgctgca acaggagaac      1140
     gagaacaagc gccagcagct gctgcatcag cagagtgccc gccactacca gctggcgctg      1200
     gtcggtctgc tggccagtgc cctgctgctg ctgggcgtca ccacccaccg gctgcaccgc      1260
     agctcgcgcc acctctacaa gctggccacc ttcgatcagc tgaccgagct gcccaatcgc      1320
     cgcgccctgc tggaacggct ggccacccag tggcagcaag agggcccgct caccctgctg      1380
     atcatcgaca tcgatcactt caagcagatc aacgaccgtc acggccatca ggcgggagac      1440
     agggccattc agcggctggc gcgggagctg agatcctggg cgcccgacct gcaactggtc      1500
     gggcgctggg gcggcgagga gtttctggta gcggtgccgc tgccggcggc ggattgctgg      1560
     tatctggcag agcagctgcg ccagcgcatc ggccagatcg acaaaccccg catgaccatc      1620
     agcatcgggg tagccggccg ctcggccgcc gatgacgggt tgggccagct catccatcgg      1680
     gccgacatgg ccatgtatca ggccaagcgc cagggccgca accagaccat tctggccgcg      1740
     gagccgctca acccggaaca gccggaggcg ctggccagca gcgtggcctg a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page