(data stored in ACNUC7421 zone)

EMBL: CP000462.PE494

CP000462.PE494       Location/Qualifiers
FT   CDS_pept        complement(551179..551550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0518"
FT                   /product="putative fimbrial protein"
FT                   /note="identified by similarity to GB:CAA54702.1"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37893"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM5"
FT                   /protein_id="ABK37893.1"
FT                   /translation="MRCPFRTTTCDEKDIKMNTSTASVRNSAIRFASSAAAAMLLGAAL
FT                   LPATASAADGTITFTGTIYEAPCDFADNSVTCYSGTQRQTLDLASLQQAGSLNTISSTM
FT                   QYKLSAGSSNMAIVTVSYL"
     ttgcgttgcc cttttcgtac aacgacatgt gacgaaaagg acataaaaat gaacacttcc        60
     accgcttccg ttcgcaacag cgccatccgt ttcgcttctt ctgctgcggc agccatgctg       120
     ctgggtgctg ccttgctgcc tgccactgcc tccgctgccg acggcaccat caccttcacc       180
     ggcactatct acgaagcccc ctgcgacttc gccgacaaca gcgtgacctg ctattccggc       240
     acccagcgcc agaccctgga tctggccagc ctgcagcaag ccggcagcct caataccatc       300
     agcagcacca tgcagtacaa gctgtctgcc ggcagcagca acatggccat cgtcaccgtc       360
     agctacctct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page