(data stored in ACNUC7421 zone)

EMBL: CP000462.PE495

CP000462.PE495       Location/Qualifiers
FT   CDS_pept        552789..553331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0519"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39596"
FT                   /db_xref="GOA:A0KFM6"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM6"
FT                   /protein_id="ABK39596.1"
FT                   /translation="MKANKILVAMGVGSMLLCGSAVAAGGAGSGKVTFNGEIINAPCSV
FT                   APESVDQVVEMGQISTKELASGGESNSKPFSIKLLNCEISDKEDAVKVTFSGAKDPVDS
FT                   SLLVIGGGDAAGAGIKMTAPGGAPIVLGTPTAAFGLVNGDNELPFSAVLKGYADQTANP
FT                   LKAGAFTAVTNFTLSYE"
     atgaaagcta acaagattct ggttgctatg ggtgttggtt ccatgttgct gtgcggctcc        60
     gctgttgctg ccggtggcgc tggttcaggc aaagtcacct tcaatggtga aatcatcaac       120
     gctccttgct ccgttgctcc tgagtctgtt gaccaggtag ttgaaatggg tcagatcagc       180
     accaaagagc tggccagcgg tggcgagtcc aactccaagc cgttcagcat caagctgctg       240
     aactgtgaaa tctccgacaa ggaagatgcc gtcaaggtaa ccttcagcgg tgccaaagac       300
     ccggtagatt ccagcctgct ggttatcggt ggtggtgacg ccgctggtgc cggtatcaag       360
     atgaccgctc cgggtggtgc cccgatcgtg ctgggtactc cgactgccgc cttcggcctg       420
     gtcaacggtg acaacgagct gcccttcagc gccgtgctga aaggttatgc cgatcagacc       480
     gccaacccgc tgaaagccgg cgctttcact gcagtgacca actttactct ctcctacgag       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page