(data stored in ACNUC7421 zone)

EMBL: CP000462.PE498

CP000462.PE498       Location/Qualifiers
FT   CDS_pept        556433..557164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0522"
FT                   /product="fimbrial chaperone protein"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39049"
FT                   /db_xref="GOA:A0KFM9"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFM9"
FT                   /protein_id="ABK39049.1"
FT                   /translation="MKKLLSYTCLAVLGMTSLNVSAAIVLDRTRVVYPGGAKSISLNIK
FT                   NENQKLPYLAQSWIEDAQGQKIASPFAVLPPVQRVDANQKSIVRIASVPAIDSLPKDRE
FT                   SIYYFNLREIPPKSEKSNVMQIAVQSKIKLFYRPEAILPERGAIWQDQVLITKLGKALK
FT                   VNNPTPYYITYVGLGHPQGKGRTAMKGFSAFMVAPKSEQTVTIPEALGNEFVISYVNDY
FT                   GGYMDIKYQCKGDRCESVKEK"
     atgaaaaagc tgctctctta tacctgtctg gccgtgctgg gcatgacctc gctcaacgtc        60
     agcgctgcca tcgtgctgga ccgtactcgt gtcgtctatc cgggcggtgc caagtccatc       120
     agcctcaaca tcaagaacga gaaccagaag ctgccctacc tggcgcagtc ctggattgaa       180
     gatgcccagg gtcagaagat cgcgtctccc ttcgcggtgc tgccgccggt acagcgggtg       240
     gatgcgaacc agaagtccat cgtgcggatc gccagcgtgc cggccatcga cagcctgccc       300
     aaggatcgcg agtccatcta ctacttcaat ctgcgcgaga tcccgcccaa gagcgagaag       360
     agcaacgtga tgcagattgc cgtgcagtcc aagatcaagc tgttctaccg cccagaggcc       420
     atcctgcccg agcgcggtgc catctggcag gatcaggtgt tgatcaccaa gctgggcaag       480
     gccctcaagg tcaacaaccc gactccttac tacatcacct acgtgggcct aggccatccg       540
     cagggcaaag ggagaaccgc gatgaagggc ttctcggcct ttatggttgc ccccaagtca       600
     gagcagacgg tcaccatccc ggaagcactg ggcaatgaat ttgtgatcag ctacgtcaat       660
     gactacggcg gatatatgga tatcaaatac cagtgtaaag gtgaccgctg tgaaagcgtt       720
     aaagagaagt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page