(data stored in ACNUC7421 zone)

EMBL: CP000462.PE5

CP000462.PE5         Location/Qualifiers
FT   CDS_pept        complement(6409..6786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0005"
FT                   /product="glyoxalase family protein superfamily"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38384"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF0"
FT                   /protein_id="ABK38384.1"
FT                   /translation="MLVPQFTILYVANPARSTLFYRELFGRPPVEESPTFAMFVFESGA
FT                   RLALWSSATVEPAVTQTAGAMELAFALPNDTAVDRQSAEWQARGLTLIQAPTRMEFGYT
FT                   CMALDPDGHRLRLYCPAPELG"
     atgttagtcc cccagttcac catcctctat gttgccaacc cggctcgcag cacgctcttc        60
     tatcgcgagc tgttcggacg cccaccggtg gaggagtccc ccacctttgc catgttcgtg       120
     ttcgaatcgg gcgccagact ggcactttgg tccagcgcca cggtcgagcc tgccgtgacc       180
     caaacggccg gggccatgga gctggccttc gccctcccca atgataccgc ggtcgataga       240
     cagtctgccg agtggcaggc acgcgggctc accctgatcc aggcgccgac ccggatggag       300
     tttggctaca cctgcatggc gctcgatccg gatggccatc gtctgcgcct ctactgcccg       360
     gcccccgaac tgggctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page