(data stored in ACNUC7421 zone)

EMBL: CP000462.PE500

CP000462.PE500       Location/Qualifiers
FT   CDS_pept        558215..558766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0524"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36075"
FT                   /db_xref="GOA:A0KFN1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN1"
FT                   /protein_id="ABK36075.1"
FT                   /translation="MLRTLLISLMLSPLIAVAAIPRAGDGLELRGDKLNLHGRIIDQPC
FT                   VVAPESLEQEVEMGVVDVKQLYANGAGEQVPFSIRLTNCKPGIFRMAKVTFTGSKDAQL
FT                   SGGLAFTAGIAKGAGIRLYDVTQTPLDLGTPSRGYLLGGSADNELQFFARVEGHPDALA
FT                   AKNIQPGDYSAVANFIVAYE"
     atgttacgaa cattgttgat cagtttgatg cttagcccgt tgattgctgt tgcagctata        60
     cctcgtgctg gtgatggatt ggaactgcgt ggtgacaagc taaacctcca tggccggata       120
     atcgaccagc cctgtgtggt cgcccccgaa tcccttgagc aggaggtcga gatgggggtg       180
     gtcgatgtca agcagctcta tgccaacggg gccggggagc aggtaccttt ctccatccgc       240
     ctgaccaact gcaagccggg gattttccgc atggccaagg tgacctttac cggctcgaag       300
     gatgcccagc tcagcggcgg gctggccttt accgcgggca ttgccaaggg cgccggcatc       360
     cgcttgtatg acgtgaccca gacacccctg gatctgggca ctccctcccg cggttatttg       420
     ctgggcggca gcgcagacaa tgaactgcaa ttctttgccc gggtggaagg gcacccggac       480
     gcgctggcgg ccaagaacat ccagcccggt gactattctg ccgttgccaa cttcatcgtt       540
     gcttatgaat aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page