(data stored in ACNUC7421 zone)

EMBL: CP000462.PE502

CP000462.PE502       Location/Qualifiers
FT   CDS_pept        complement(559449..560009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0526"
FT                   /product="transcriptional regulatory protein, C terminal"
FT                   /note="identified by match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39625"
FT                   /db_xref="GOA:A0KFN3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN3"
FT                   /protein_id="ABK39625.1"
FT                   /translation="MSNKNYKIAEEIFFSAAIFRLSKGEKDIKLSNKEAELLEMLCDEA
FT                   GSVIPRSKLQDALWPNQDNTDTNLNRQILSLRRKLESFGLMDAIDTIPRVGYIFCAPIE
FT                   AAGETEEAAPNEETQAANPSHAPQARRQYTRRKYDRYFSPKRILLFALLLVSLTSLAIV
FT                   IYNYATANTLRTINLSQISLYSI"
     atgagtaaca aaaattataa aattgcagag gagatatttt tctccgcggc aatattccga        60
     ctctctaagg gagaaaagga catcaagctc agcaacaaag aagccgagct gctcgaaatg       120
     ctgtgtgatg aggcaggcag tgtcattcca agaagcaaac tgcaagatgc cttgtggcca       180
     aaccaggaca ataccgatac caacctgaac cggcagatcc tctcattgag aagaaagctg       240
     gaatcattcg gtttaatgga tgcgatcgat accattccac gcgtgggata tatcttttgt       300
     gcccctattg aggccgcagg agagaccgaa gaagctgcac caaatgaaga aacgcaagcg       360
     gcgaatcctt ctcatgcgcc tcaggccaga cggcaatata ctcgccgcaa atatgaccgc       420
     tatttcagcc caaagcgtat tctgctgttt gctctgctgc tggtctcact gacttcgctg       480
     gccatcgtca tctataacta tgcgacggca aatacgctgc gtaccatcaa tctcagccag       540
     atttccctct actctatatg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page