(data stored in ACNUC7421 zone)

EMBL: CP000462.PE506

CP000462.PE506       Location/Qualifiers
FT   CDS_pept        complement(563510..564280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0530"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38232"
FT                   /db_xref="GOA:A0KFN7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN7"
FT                   /protein_id="ABK38232.1"
FT                   /translation="MAASADQPTLVLLHGLLGDAHDWQPVQAALAGLPSLALDLPGHGS
FT                   NRAVRVAGFEQAHRWLCDELAARDIDRYQLVGYSLGGRLALYHASQSLVGLQALLLENC
FT                   HPGLPPAERPARLAHDEGWARRFEQEPLAAVLADWYRQGVFADLGEDARARQIARRLGN
FT                   DGEAVAAMLRATSLGQQPNLGPWLAQGALPVTWVSGKRDHKFHQLACLMASQHRKINHL
FT                   ELDGGHNLHAHQPETFARLLAEWVNQQQEEKRHD"
     gtggcagcta gtgccgatca accgacgctg gtgctgctgc acggcctgct cggcgatgcc        60
     cacgactggc agcccgtgca ggcggccctg gccggcctcc ccagcctggc gctggatctg       120
     ccgggccacg gcagcaaccg ggctgtgcgg gttgcggggt tcgagcaggc ccatcgctgg       180
     ctgtgcgacg agctggccgc gcgcgacatc gatcgctacc aactggtggg ctattcgctg       240
     ggcgggcgac tcgccctcta tcacgccagc cagtcgctgg ttgggttgca ggccctgctg       300
     ctggaaaatt gccaccccgg cctgccaccg gcagagcggc ccgcccgcct cgcccacgat       360
     gagggctggg cccggcgctt cgagcaggag cccctggcgg ccgtgctggc cgactggtat       420
     cggcaggggg tgttcgccga tctgggtgag gatgcccgcg cgcgccagat agcccgccgc       480
     cttggcaacg acggcgaggc cgtggccgcc atgctgcgcg ccacctccct gggccagcag       540
     cctaatctcg gcccctggct ggcgcaaggt gcgctgccgg tcacctgggt gagcggcaag       600
     cgggatcaca aattccatca gctggcttgc ctcatggcga gtcagcatcg caaaatcaac       660
     cacttggagc tggatggcgg ccacaatctg catgcccacc agcctgagac ttttgcccgg       720
     ctcctcgcgg agtgggtcaa ccaacaacaa gaagagaagc gtcatgattg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page