(data stored in ACNUC7421 zone)

EMBL: CP000462.PE510

CP000462.PE510       Location/Qualifiers
FT   CDS_pept        568547..568816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38883"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP1"
FT                   /protein_id="ABK38883.1"
FT                   /translation="MLVGVCWPANHSSGRNAAMRDSLKQKIIQVCHQKIAQKGEAVGVS
FT                   FYAFFTNRNDDPELLMEAATWWIQTQRLDHFEKATKILQLVEQA"
     ttgttggttg gggtatgctg gccggccaat cactcatcag gtcggaacgc cgccatgcgc        60
     gactcgctca aacagaaaat cattcaggtg tgccatcaga aaatcgcgca gaagggggag       120
     gcggtcggcg tctccttcta tgcgttcttt accaaccgca acgatgatcc cgagttgctg       180
     atggaggcgg cgacttggtg gatccagacc cagcgcctcg atcacttcga gaaggcgacg       240
     aagatcctcc agctggtgga gcaagcgtaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page