(data stored in ACNUC7421 zone)

EMBL: CP000462.PE511

CP000462.PE511       Location/Qualifiers
FT   CDS_pept        complement(568896..570293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0535"
FT                   /product="propeptide, PepSY amd peptidase
FT                   M4:PepSY-associated TM helix"
FT                   /note="identified by match to protein family HMM PF03413;
FT                   match to protein family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37297"
FT                   /db_xref="GOA:A0KFP2"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP2"
FT                   /protein_id="ABK37297.1"
FT                   /translation="MKNRDANHYQRIWRWHFYAGLFVAPFLILLSLTGIVYLFKPQLDN
FT                   LMYPELMKVAPVSQPLSADQLLVKAMVTMPDASLSKYLPPVSPEASAQFIVRQGGNELT
FT                   LFLDPASGTLLGTLDNKWNLQAVARALHAELMIGTVGDRLIELAAGWGIVLLISGLYLW
FT                   WPRKGPGVGGILWPRWSQRGRLWWRDLHAVVGFWGAGFLLLLLLSGMTWTGFWGDQFAA
FT                   VWNRFPAAMWNEVPKSAPLARSLNHAHQQTVPWAVENTPIPSSAEPKAHDHSAMGHGGE
FT                   HDGMVMTEHRIPLQQVVEIATARQVTPGYSITPPAGASGVYTIAISADDPRNDATLHID
FT                   QYSGKVLADVRWQDYGPVAKTVETGVMLHMGKLYGWPHQLAMLLICLLVLLSSVSGLWI
FT                   WWSRRPSGRLAAPPLPASLPPMRGAIALLILLGICFPLVGGSMLVIWLLDCLLFARRRA
FT                   PRLARVS"
     atgaaaaatc gggacgcgaa ccactatcag cgcatctggc gctggcactt ctatgcgggt        60
     ctcttcgtcg cccccttcct gatcctgctc tcgctgaccg ggatcgtcta tctgttcaag       120
     ccccagctcg acaacctgat gtatcccgag ctgatgaagg tcgcccccgt cagccagccg       180
     ctcagcgccg atcagctgct ggtcaaggcg atggtgacga tgccggatgc cagcctgagc       240
     aagtacctgc caccggtcag cccggaggcc agcgcccagt tcatcgtccg ccagggcggc       300
     aacgagctga ccctgttcct cgatcccgcc agcggcaccc tgctcggcac cctggacaac       360
     aagtggaatc tgcaggcagt ggcccgcgcc ctgcacgccg agctgatgat aggcacagtg       420
     ggggacaggc tgattgagct ggctgccggc tggggaatag tgctgctcat cagcgggctc       480
     tatctctggt ggccacgcaa ggggccaggg gttggcggca tcctgtggcc gcgctggagc       540
     cagcgcgggc ggctctggtg gcgcgacctg cacgccgtgg tcggtttctg gggggccggc       600
     ttcctgttgc tgctgctctt gagcggcatg acctggaccg gtttctgggg cgatcagttt       660
     gccgccgtct ggaatcgctt cccggccgcc atgtggaatg aggtgcccaa gtcggcgccc       720
     ctggcgcgta gcctcaacca tgcccatcaa cagacagtcc cctgggcggt cgagaacacc       780
     cccatcccca gctcggccga gcccaaggcc cacgaccaca gcgccatggg tcacggcggc       840
     gagcacgacg gcatggtgat gacggagcac cgcatcccgc tgcaacaggt ggtggagatc       900
     gccactgcac gccaggtcac gccgggctac agcatcacgc caccggccgg ggcgagcggc       960
     gtctacacca tcgccatctc tgccgatgat ccgcgcaacg atgccaccct gcacatcgat      1020
     caatacagcg gcaaggtgct ggccgacgtg cgctggcaag actacggccc ggtcgccaag      1080
     acggtggaaa ccggcgtcat gttgcacatg ggcaagctct acggctggcc gcaccagctg      1140
     gccatgctgc tcatctgcct gctggtgttg ctgagctcgg tgagcgggct ctggatctgg      1200
     tggagccgcc gccccagtgg tcgcctcgcc gccccgccct tgccggccag cctgcccccc      1260
     atgcgcggcg ccattgccct gctgatcctg ctcggtatct gcttcccgct ggtgggcggc      1320
     tccatgctgg tgatctggct gctggactgc ctgctcttcg cccgccgtcg ggcgcccagg      1380
     ctggcacggg tcagctag                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page