(data stored in ACNUC7421 zone)

EMBL: CP000462.PE512

CP000462.PE512       Location/Qualifiers
FT   CDS_pept        570566..570961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38999"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP3"
FT                   /protein_id="ABK38999.1"
FT                   /translation="MKLQPHGHFEMQRRGQVLICRPSGPFNLAGAMAYEAQFSQQIASL
FT                   RDAPWGIVEVATEFEAAGPEVLTRFRRQFGWCASNGCAFLAVVLAGSFKQYLADQVFSG
FT                   LPFQGVRYFEQTDEALQWLERQLAGLV"
     gtgaagttgc aaccacacgg ccatttcgag atgcagcgac gaggtcaggt gctgatctgc        60
     cgaccgagcg gccctttcaa tctggcgggg gccatggcct atgaggctca gttcagccag       120
     cagatcgcca gcctgcgcga cgcgccctgg ggcattgtcg aagtggcgac cgagttcgag       180
     gcggcgggcc ccgaggtgct gacccgcttt cgccgccagt tcggctggtg cgccagcaac       240
     ggctgcgcct ttctggcggt ggtgctggcg ggcagcttca agcagtatct ggcagatcag       300
     gtgttcagcg gtttgccgtt tcaaggcgtc cgctacttcg agcagaccga cgaggcgctg       360
     cagtggctgg aacggcaact ggccgggctg gtctga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page