(data stored in ACNUC7421 zone)

EMBL: CP000462.PE513

CP000462.PE513       Location/Qualifiers
FT   CDS_pept        complement(571145..571435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36379"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP4"
FT                   /protein_id="ABK36379.1"
FT                   /translation="MTQTTRPEVSCQNCEACCCRLEVMLFTDTGVPDRYVEEREGEVPV
FT                   MHRLEDGWCAALDRNTMMCRIYEVRPLICREFEMGEPDCIDERDKWFIKLN"
     atgacccaga caacccgacc cgaagtgagc tgccagaact gcgaagcctg ctgctgccgc        60
     ctcgaggtga tgctgtttac cgataccggc gtaccggatc gctatgtgga agaacgggaa       120
     ggtgaagtgc cggtgatgca ccggctggaa gatggctggt gcgcggcgct cgaccgcaac       180
     accatgatgt gccgcatcta cgaagtccgc cccttgatat gccgtgaatt tgaaatgggc       240
     gagccagact gtatcgacga gcgggacaag tggtttatca agctcaactg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page