(data stored in ACNUC7421 zone)

EMBL: CP000462.PE515

CP000462.PE515       Location/Qualifiers
FT   CDS_pept        573287..574654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0539"
FT                   /product="nucleoside permease NupC"
FT                   /note="identified by match to protein family HMM PF01773;
FT                   match to protein family HMM PF07662; match to protein
FT                   family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37802"
FT                   /db_xref="GOA:A0KFP6"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP6"
FT                   /protein_id="ABK37802.1"
FT                   /translation="MIRCLRERLINLKTFVLSNMHIFTADCDGYLIFKYANVYDGAGQK
FT                   ITNYSGATGMEYVHFVLGLVMVLALALLANRHNWKQIKLRYIGQLLVVELALAWFMLNS
FT                   EVGLAVVGGFAAGFTKLMEFAKQGTDFVFGGLVNEGAFSFFLMVLMPIVFISVLIGILQ
FT                   YIRLLPLVIRGIGTVLAKINGMGKLESFNAISSMIVGQSENFIALKNILPHLNEKQMYT
FT                   LAATAMSTVSMSIVGAYMQLIEPRYVVAALVLNMFSTFIVLSLINPYEPDNTVTDAKAL
FT                   AEGDEHHSPKKENFFEMLGEYIMAGFTVAVIVGAMLVGFIALIALINYLFEMAFGVNFQ
FT                   FVMGYLFYPIAWILGIPSGEALQAGSIMATKLVTNEFVAMMDLGKIAAQLSPRTIGILS
FT                   IFMVSFANFSSIGIIAGAVKALNEEKGNMVSRFGLKLVYGSTLVSLLSAVIAGVML"
     atgattagat gcttgcgtga gcgtttaatt aatttaaaaa cgtttgtatt atccaacatg        60
     catattttta ccgcagattg tgatggctat ctgattttta aatatgcaaa tgtctatgat       120
     ggcgccggtc aaaaaattac aaattactca ggtgctactg gtatggaata cgttcacttt       180
     gtgctcggac tcgtgatggt cctcgctctt gctttgctgg ccaaccgcca caactggaaa       240
     cagatcaaac tgcgttatat cggccaactg ctggtggtcg aactggcgct ggcctggttc       300
     atgctgaact ccgaagtggg tctggcggtg gtgggtggct tcgcggccgg cttcaccaag       360
     ttgatggagt ttgccaaaca gggtaccgac ttcgtgttcg gcggcctggt caatgaaggg       420
     gccttctcct tcttcctgat ggtactgatg cccatcgtct tcatctccgt gctgatcggt       480
     atcctgcagt acatccgtct gctgccgctg gtgatccgcg gcatcggtac cgtgctggcc       540
     aagatcaacg gcatgggcaa gctggagtcc ttcaacgcca tcagctccat gatcgtcggc       600
     cagtccgaga acttcatcgc gctcaagaac atcctgccgc acctgaacga gaagcagatg       660
     tacaccctgg ccgccactgc catgtccacc gtctccatgt ccatcgtcgg tgcctacatg       720
     cagctgatcg agccgcgcta cgtggtggcc gcgttggtgc tcaacatgtt cagtaccttc       780
     atcgtgctgt cgctgatcaa cccctacgag ccggacaata ccgtgaccga cgccaaggcg       840
     ctggccgaag gtgacgagca ccacagcccg aagaaagaga acttcttcga gatgctgggc       900
     gagtacatca tggccggttt caccgtggcg gtcatcgtgg gtgccatgct ggtcggcttc       960
     atcgccctga ttgccctcat caactacctg ttcgagatgg cattcggcgt caacttccag      1020
     ttcgtcatgg gctacctctt ctacccgatc gcctggatcc tgggcatccc gagtggtgaa      1080
     gcgctgcaag ccggctccat catggcgacc aagctggtga ccaacgagtt cgtggccatg      1140
     atggatctgg gcaagattgc tgcccagctc tctccgcgta ccatcggcat cctctccatc      1200
     ttcatggtgt cgttcgccaa cttcagctcc atcggcatca tcgccggtgc ggtgaaggcg      1260
     ctgaacgaag agaagggcaa catggtctcc cgcttcggtc tgaagctggt gtacggctcc      1320
     accctggtga gtctgctctc cgccgtgatt gccggtgtga tgctgtaa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page