(data stored in ACNUC7421 zone)

EMBL: CP000462.PE517

CP000462.PE517       Location/Qualifiers
FT   CDS_pept        complement(575340..575894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0541"
FT                   /product="cytochrome B"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38696"
FT                   /db_xref="GOA:A0KFP8"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP8"
FT                   /protein_id="ABK38696.1"
FT                   /translation="MTTSEVKVWDPLIRVFHWATVTLCLLNFFVLEEGSKPHKYAGYTV
FT                   GILLIIRLLWGLVGPHYARFGQWWPTPARVRYYLRQLAQGSHPYYLGHNPVGALMIWLL
FT                   LLSLVGTVVTGWLTTWDAFWGEDWLEELHGIIANTLMAAVGVHAAVVILTDRLTRSDLV
FT                   RAMVLGKKRVPADAKVEDPRS"
     atgacaacct ctgaagtgaa agtctgggat cccctcatcc gggtgtttca ctgggccacc        60
     gtcaccctct gcctgctcaa cttcttcgtg ctggaggagg gcagcaagcc ccacaaatat       120
     gccggctaca cagtgggcat cctgctgatc atccgcctgc tgtgggggct ggtcggtccc       180
     cattacgccc gcttcggcca atggtggccg accccggccc gggtgcgcta ctacctgcgc       240
     cagctggccc agggcagtca cccctactac ctcggccaca acccggtcgg cgccctgatg       300
     atctggctgc tgctgctgtc gctggtcggc accgtcgtca ccggctggct caccacctgg       360
     gatgccttct ggggcgaaga ctggctggag gagctgcacg gcatcattgc caacaccctg       420
     atggctgccg tcggcgtcca tgcagccgtg gtgatcctga ccgatcgcct cacccgtagc       480
     gacctggtgc gcgccatggt gctgggcaaa aaacgggtgc ccgccgacgc caaggtggaa       540
     gatccgcgca gttaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page