(data stored in ACNUC7421 zone)

EMBL: CP000462.PE518

CP000462.PE518       Location/Qualifiers
FT   CDS_pept        complement(575943..576212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAY38542.1"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38244"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP9"
FT                   /protein_id="ABK38244.1"
FT                   /translation="MKLTPLLLLIPLLSGAALADPQCTQADKSKWMSEADAQQQIKAMG
FT                   YDIKKFKVTKTNCYEIYGWDKEKRKVEIYFDPTDLKKVKEEIDE"
     atgaaactga cccccctgtt gttactgatc cccctgttga gcggcgcagc cctggccgat        60
     ccccaatgta cccaggccga caagagcaag tggatgagcg aagccgacgc tcagcagcag       120
     atcaaggcga tgggctatga catcaagaag ttcaaggtca ccaagaccaa ctgctacgag       180
     atttacggtt gggacaagga gaagcgcaag gtcgagatct acttcgaccc gaccgatctg       240
     aagaaagtca aagaagagat cgacgaataa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page