(data stored in ACNUC7421 zone)

EMBL: CP000462.PE519

CP000462.PE519       Location/Qualifiers
FT   CDS_pept        complement(576334..576786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0543"
FT                   /product="YaiI/YqxD family protein"
FT                   /note="identified by match to protein family HMM PF02639"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39838"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFQ0"
FT                   /protein_id="ABK39838.1"
FT                   /translation="MPIWVDADACPIPVKEILYRAAHRAQVVTTLVANQGLRVPPSPFI
FT                   KTQQVEKGFDVADHVIAQQVKPGDLVITGDIPLASWVIDAGGEALNPRGEIYTRETIKA
FT                   RLGMRNFMEELRSAGVQTGGPAPLNAADKQRFANALDKWLIRGKLS"
     atgcccatct gggtcgatgc cgatgcctgc cccattccgg tcaaggagat cctttaccgc        60
     gccgcccacc gtgcccaggt ggtgaccacg ctagtggcca atcaggggct gcgggtgcct       120
     ccttccccct tcatcaagac ccagcaggtg gagaagggct tcgatgtggc agatcatgtc       180
     atcgcccagc aggtcaaacc cggcgatctg gtgatcaccg gcgacatccc gctcgcctcc       240
     tgggtgatcg atgccggcgg cgaggcgctc aatccccgcg gcgagatcta cacccgcgag       300
     accatcaagg cgcggctcgg catgcgcaac ttcatggagg agctgcgctc ggccggggtg       360
     cagaccggcg gcccggcccc cctcaacgcg gccgacaagc agcgcttcgc caacgccctc       420
     gacaagtggc tcatccgggg caagctgagt tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page