(data stored in ACNUC7421 zone)

EMBL: CP000462.PE521

CP000462.PE521       Location/Qualifiers
FT   CDS_pept        577894..578412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36447"
FT                   /db_xref="GOA:A0KFQ2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ2"
FT                   /protein_id="ABK36447.1"
FT                   /translation="MTTWESFGVTLLLLLGHTLVRGLIHKSLLALAQTRQVSENRVLYV
FT                   EHVFHFLLGCATLLILAGVWGLDFSRLVVLASSFFAVLGVAMVAQWSILSNITASITIF
FT                   FAFPYKIGDRIRILDKDDSVTGVITEIGLFYVRVRDDNGDLVTYPANLILQKPVRRLEG
FT                   KGVEPLQPE"
     atgacgacat gggaatcttt tggcgtgacc ctgctgttgc tgctgggcca caccctcgtt        60
     cgcgggctca ttcacaagag cctgctggcg ctggcccaga cccggcaggt gagcgagaac       120
     cgggtgctct acgtggagca cgtgttccac ttcctgctcg gctgcgccac cctgctgatc       180
     ctggccgggg tgtgggggct cgacttctcg cggctggtgg tgctggcctc ctccttcttt       240
     gcggtgcttg gcgtcgccat ggtggcgcag tggtcgatcc tctccaacat caccgccagc       300
     attaccatct tcttcgcctt cccctacaag attggcgacc ggatccggat cctcgacaag       360
     gatgactcgg tcaccggggt catcaccgag atcggcctct tctacgtacg ggtgcgcgat       420
     gacaatggcg atctggtcac ctatccggcc aacctgatcc tgcaaaagcc ggtcaggcgg       480
     ctggagggca agggggtgga acccctgcaa ccggaatga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page