(data stored in ACNUC7421 zone)

EMBL: CP000462.PE524

CP000462.PE524       Location/Qualifiers
FT   CDS_pept        complement(579339..581294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0548"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37889"
FT                   /db_xref="GOA:A0KFQ5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ5"
FT                   /protein_id="ABK37889.1"
FT                   /translation="MAAVSGHTPPLSRGHAPVTPAVARSASPLVPAADWCQSDHLPHYT
FT                   SSRFIALIEVCMIALSLAGIALVSVLAQWLAWSLRVPAILFLLLTGLLLGPVSGLLDPD
FT                   ALLGDLLFPLVSLSVAIILFEGALTLHLAELKGIGKVVRNLCSVGMLASFAVIGSAGYF
FT                   LLGLDWRVAMVLGAVLVVTGPTVVAPMLNVIRPTREVDRILRWEGIVIDPIGALFAVLV
FT                   FEAVRLGSQGDLIGHTLLALAKTVGVGSLIGVGAGWLTTLLIRKDWLPVSLHKFGVLAL
FT                   VLVTFSLSNWLSHESGLLAVTVFGIWLANQEGLDLEEVLAFKEDLAVILISSLFILLAA
FT                   RLDLAQLWQLGPMVLALLCVVQFVARPLCILVSTWGSDLSWRARALLGWIAPRGIVAAA
FT                   VSASFAISLHQAGIPDADKLVPLVFAVIISTVVLQSLTSAPLAGLLKMRQSAPNTWLII
FT                   GANSVARAIGKALADQGVPVQLCDPAWEFCKQARMSNLPCYFGNPQSEHAELHLPLTSI
FT                   STVLALSPNRHNNALGVLHFAHLYGEEKVYSLRSSEQHGKANRESATFRARQNLFGPDI
FT                   NYARLSGLLSRGGQIKATRLSEAFDWTQYQEANPGAIPLFVLDGKGRARIVTGPVEPLA
FT                   GELLIALQPPKETATP"
     gtggccgcag ttagcggcca caccccgccc ctctcccgcg gtcatgcccc cgtgacgccc        60
     gctgtcgcgc gatccgcttc cccccttgtt cccgccgccg actggtgtca atctgaccat       120
     cttccccact acacttcctc caggttcatc gccttaatcg aggtctgcat gattgctctc       180
     tccctggccg ggatcgccct ggtctcagtg ctggcccagt ggctggcctg gtcgctgcgg       240
     gtgcccgcca tcctgtttct gctgctcacc ggcctgctgc tgggcccggt cagcggcctg       300
     ctcgaccccg acgccctgct cggtgacctg ctgtttccgc tggtctccct gtcggtcgcc       360
     atcatcctgt tcgagggagc gctcaccctg cacctggccg agctgaaagg gatcggcaag       420
     gtggtgcgca acctctgctc ggtgggcatg ctggccagct tcgccgtcat cggcagcgcc       480
     ggttacttcc tgctggggct ggactggcgg gtcgccatgg tgctcggcgc cgtgctggtg       540
     gtgaccggcc ccaccgtggt cgcccccatg ctcaacgtga tccgcccgac ccgggaggta       600
     gaccgcatcc tgcgctggga ggggatcgtc atcgatccca tcggcgccct gtttgcggtg       660
     ctggtgttcg aggcggtgcg cctcggcagc cagggagatc tcatcggcca caccctgctg       720
     gcgctggcca aaacggtggg ggtagggtcg ctcatcgggg tcggcgccgg ctggctcacc       780
     accctgctga tccgcaagga ctggctgccg gtcagcctgc acaagttcgg ggtgctggcg       840
     ctggtgctgg tcaccttcag cctctccaac tggctcagcc acgaatccgg cctgctggcg       900
     gtcaccgtgt tcggcatctg gctcgccaat caggaggggc tggatctgga ggaggtgctg       960
     gccttcaagg aggatctcgc cgtcatcctc atctcctccc tgttcatcct gctggcggcc      1020
     cgcctcgatc tggcccagct ctggcagctc ggccccatgg tgctggcgct gctgtgcgtg      1080
     gtgcagttcg tggcgcgccc gctctgcatt ctggtctcca cctggggatc ggatctctcc      1140
     tggcgggccc gcgccctgct cggctggatt gcgccgcgcg gcatcgtcgc ggcggcggtc      1200
     agcgcctcgt tcgccatcag cctgcaccag gccggtattc ccgatgccga caagctggtc      1260
     cccctggtgt ttgcggtgat catctccacc gtggtgctgc agagcctcac ctcggcgccg      1320
     ctggccggcc tgctcaagat gcgccagagc gcccccaaca cctggctcat catcggggcc      1380
     aactcggtgg cgcgggccat cggcaaggcg ctggcggatc agggggtgcc ggttcagctc      1440
     tgcgatcccg cctgggagtt ctgcaaacag gcgcggatga gcaacctgcc ctgctacttc      1500
     ggcaacccgc aatccgaaca cgccgagctg cacctgccgc tcaccagcat cagcacagtg      1560
     ctggcgctct cccccaaccg ccacaacaac gccctcggcg tgctgcactt cgcccacctc      1620
     tacggcgagg agaaggtcta ctccctgcgc tccagcgagc agcacggcaa ggccaatcgg      1680
     gagagcgcca cctttcgcgc ccgccagaac ctgttcggtc ccgacatcaa ctacgcccgg      1740
     ttgagcggcc tgctgagccg gggcggccag atcaaggcga cccggctgag cgaggcgttc      1800
     gattggaccc agtaccagga ggccaacccg ggcgccattc cgctgttcgt gctggacggc      1860
     aaggggcggg cccgcatcgt caccggcccc gtcgaaccgc tggccgggga gctgctgatc      1920
     gccctgcaac cgccgaagga gacggccacc ccatga                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page