(data stored in ACNUC7421 zone)

EMBL: CP000462.PE526

CP000462.PE526       Location/Qualifiers
FT   CDS_pept        complement(581933..583201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0550"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /note="identified by match to protein family HMM PF01232;
FT                   match to protein family HMM PF08125"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36112"
FT                   /db_xref="GOA:A0KFQ7"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFQ7"
FT                   /protein_id="ABK36112.1"
FT                   /translation="MNPASSTGWPAPRIPRSSWICWVPNRLPDRPSSSLVQEVNIMKTL
FT                   HFGAGNIGRGFIGKLLADASHQVTFADVNETLIDQLNHRQEYKVHVVGADQKLDVVRNV
FT                   AAVSSAGHEVIARIITADLVTTAVGPNILDKIASTLAKGLQARFDAGNLTPLNVIACEN
FT                   MVRGTSHLKQEVLKYLPVAYHATLDACIGFVDSAVDRIVPPAAANDDPLEVTVESFSEW
FT                   IVDQTQFKGELPQVAGMEPTDNLMAFVERKLFTLNTGHIVTAYLGKLRGYRTIREAIED
FT                   PLIRSKVRRAMEESGAVLVQRYGFDPRLHAAYIEKILARFANPYLVDEIDRVGRQPLRK
FT                   LAAGDRLVKPLLGTLEYGLPSDHLQEGIAAALHYRNADDPQAVELQQLLAELGPAQALA
FT                   RITGLAADSDIVSAIVTRYGNLK"
     atgaacccgg cctcatcgac cggctggcca gcacccagga tccccaggag ttcctggatc        60
     tgctgggtgc cgaacaggct gcctgatcgt ccttcatcgt ctttggttca agaggttaat       120
     ataatgaaaa cattgcattt tggtgccggc aacatcggtc gcggcttcat cggcaaactg       180
     ttggctgacg ccagccacca ggtcaccttc gccgacgtca acgagaccct gatcgaccag       240
     ctcaaccacc gccaggagta caaggtgcac gtggtgggag cggatcagaa gctggacgtg       300
     gtgcgcaacg tggcggcggt gagctccgcc ggccacgagg tgatcgcccg catcatcacc       360
     gccgatctgg tcaccaccgc ggtcggcccc aacattctgg acaagattgc cagcaccctg       420
     gccaaggggc tgcaggcccg cttcgatgcc ggcaacctga caccgctcaa cgtcatcgcc       480
     tgcgagaaca tggtgcgcgg caccagccat ctcaagcagg aggtactcaa gtacctgccg       540
     gtcgcgtatc atgccaccct cgacgcctgt atcggcttcg tcgactcggc ggtggaccgc       600
     atcgttccgc cggcggctgc caacgatgat ccgctggagg tgacggtgga gagcttcagc       660
     gagtggatcg tcgaccagac ccagttcaag ggcgagctgc cgcaggtggc gggcatggag       720
     cccaccgaca acctgatggc cttcgtcgag cgcaagctgt tcaccctcaa caccggccac       780
     atcgtcaccg cctacctcgg caagctgagg ggctatcgca ccatccgcga ggcgatcgag       840
     gatccgctga tccgcagcaa ggtgcgtcgc gccatggagg agagcggcgc cgtgctggtg       900
     caacgctacg gtttcgaccc gcgcctgcac gccgcctaca tcgagaagat cctggcccgc       960
     ttcgccaacc cctatctggt ggatgagatt gaccgggtcg gccgtcagcc gctgcgcaag      1020
     ctggcggcgg gggatcggct ggtgaagccg ctgctcggca ccctcgagta cggcctgccg      1080
     agcgatcacc tgcaggaggg gatcgccgcg gcgctgcact atcgcaacgc cgacgacccg      1140
     caggcggtgg aactgcaaca gctgctggcg gagctgggcc cggcccaggc tctggcgcgc      1200
     atcaccggcc tggctgccga cagcgacatc gtcagcgcca tcgtcacccg ttatggcaat      1260
     ttgaagtga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page