(data stored in ACNUC7421 zone)

EMBL: CP000462.PE53

CP000462.PE53        Location/Qualifiers
FT   CDS_pept        60918..61556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0057"
FT                   /product="lysine exporter protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39777"
FT                   /db_xref="GOA:A0KEC1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC1"
FT                   /protein_id="ABK39777.1"
FT                   /translation="MFESLGVINVWTYLVGLFFIIIAPGPNSIYVLRTGASRGVGPGYQ
FT                   AALGVFVGDAILIFCAYLGIASLIRTTPLLFTLVRYLGALYLLYLGVKILHANFIARRE
FT                   GQASVVEHGERYFSKALTLSLTNPKAILFYVSFFVQFVDFNYAHTWVSYLVLASMLEAM
FT                   SFVYLTLLIFGGTLMARFFARKVRLARLGNGLIGLFFMGFAARLATLSS"
     atgttcgaaa gcctgggagt catcaatgtc tggacttatc tggtcgggct cttcttcatc        60
     atcatagcgc cggggcccaa ctcgatttat gtgctgcgca ccggggcgag ccgcggcgtc       120
     ggcccgggct accaggcagc cctcggggtc ttcgtcggcg acgccattct gatcttctgc       180
     gcctatctgg gcatcgcctc cctcattcgc accacccccc tgctgtttac cctggtgcgc       240
     tacctggggg ccctctatct gctctacctc ggggtgaaga tcctgcatgc caacttcatc       300
     gccaggcggg aagggcaggc gtccgtggtc gagcacggcg agcgctactt ctccaaggcg       360
     ctcaccttga gcctcaccaa ccccaaggcg atcctgttct acgtctcctt cttcgtgcag       420
     tttgtcgact tcaactacgc ccacacctgg gtctcctacc tggtgctggc gagcatgctg       480
     gaggccatga gcttcgtcta tctgaccctg ttgatcttcg gcggtaccct gatggcccgc       540
     ttctttgcgc gcaaggtacg tctcgccaga ctcggcaacg gcctcatcgg cctgtttttc       600
     atgggcttcg ccgcccgact ggccacattg tcatcctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page