(data stored in ACNUC7421 zone)

EMBL: CP000462.PE532

CP000462.PE532       Location/Qualifiers
FT   CDS_pept        complement(590632..591255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0556"
FT                   /product="autoinducer synthesis protein AhyI"
FT                   /note="identified by match to protein family HMM PF00765"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38974"
FT                   /db_xref="GOA:A0KFR3"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR3"
FT                   /protein_id="ABK38974.1"
FT                   /translation="MLVFKGKLKEHPRWEVENELYRFRNRVFSDRLGWDVESHRGLEQD
FT                   SFDTPDTHWVLIEDEEGLCGCIRLLSCAQDYMLPSIFPTALAGEAPPRSNDVWELTRLA
FT                   IDAERAPRLGNGISELTCIIFREVYAFAKAQGIRELVAVVSLPVERIFRRLGLPIERLG
FT                   HRQAVDLGAVRGVGIRFHLDERFARAVGQPLQGAYDEARELVTE"
     atgcttgttt tcaaaggaaa attaaaagaa caccccagat gggaggtaga aaacgagctt        60
     tatcgctttc gcaatcgcgt cttctccgat cgcctcggct gggatgtgga atcccaccgc       120
     ggtctggagc aggacagttt cgatacccct gatacccact gggtgctgat cgaagacgag       180
     gaaggcctgt gcggctgcat ccgtctgctc agctgtgccc aggattacat gctgcccagc       240
     atcttcccca ccgccctcgc cggtgaagcc ccgccgcgca gcaacgacgt gtgggagctg       300
     acccgcctcg ccatcgatgc cgaacgggct ccccggctcg gcaacggcat cagcgaactg       360
     acctgcatca tcttccgcga ggtctatgcc ttcgccaagg cgcaggggat ccgcgagctg       420
     gttgccgtgg tcagcctgcc ggtggagcgg atcttccgcc gtctcggcct gcccatcgaa       480
     cggctcggtc accgccaggc ggtggatctg ggcgccgtgc gcggggtcgg gatccgcttc       540
     catctggatg agcgtttcgc ccgtgccgtc ggccagcccc tgcagggtgc ctatgacgag       600
     gcgcgcgaac tggtcaccga ataa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page