(data stored in ACNUC7421 zone)

EMBL: CP000462.PE534

CP000462.PE534       Location/Qualifiers
FT   CDS_pept        592316..592936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0558"
FT                   /product="arginine exporter protein ArgO"
FT                   /note="identified by match to protein family HMM PF01810;
FT                   match to protein family HMM TIGR00948"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37692"
FT                   /db_xref="GOA:A0KFR5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004777"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR5"
FT                   /protein_id="ABK37692.1"
FT                   /translation="MFATTLQGFTLGLAMIIPIGAQNAFVLSRGIHRNHHLLTATLCCL
FT                   CDLVLIGIGVFGGANLLAASPIGLALLTWGGVLFLGWFGIRSLRSAWRGQGAKLADSPQ
FT                   LMGVKSVLAMTLGVTLLNPHVYLDTLMLLGSFGSQFAEELRPAFAAGAMLASLVWFYSL
FT                   AFGAAALSPWLARGRVQQAIDTIVGFIMLGLALQLASGALLAS"
     atgtttgcta ccaccctgca aggcttcacc ctcggccttg ccatgatcat tcccatcggt        60
     gcccagaatg ccttcgtgct gagtcggggc atccaccgca accaccatct gctgacggcg       120
     accctctgct gcctgtgcga tctcgtgctg atcggcatcg gggtgtttgg cggggccaac       180
     ctgctggcgg ccagcccgat cggactggcc ctgctgacct ggggcggcgt gctgtttctc       240
     ggctggttcg gtatccgttc cctgcgcagt gcctggcgcg ggcagggagc caagctggcg       300
     gactcgcccc agttgatggg ggtcaagagc gtgctggcca tgaccctcgg ggtgaccctg       360
     ctcaatcccc acgtctacct ggacaccctg atgctgctcg gctccttcgg cagccagttt       420
     gccgaagagt tgcggccggc ctttgcggcg ggggccatgc tggcctcgct ggtctggttc       480
     tacagcctgg cgttcggggc ggccgccctc tcaccctggc tcgctcgcgg tagggttcag       540
     caagctattg atactattgt tggtttcatc atgctggggc tggcgttgca gctggcgagc       600
     ggggctctgc tggcgtcata g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page