(data stored in ACNUC7421 zone)

EMBL: CP000462.PE535

CP000462.PE535       Location/Qualifiers
FT   CDS_pept        593051..595042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0559"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
FT                   /EC_number="3.1.4.16"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38083"
FT                   /db_xref="GOA:A0KFR6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR6"
FT                   /protein_id="ABK38083.1"
FT                   /translation="MNKTMKLGAIAAIVLLSACSNENDSKAQPGEVALRLIQTSDIHSN
FT                   VLGYDYYQNKEDRKFGLSRTALLIRAARAENPNNLLLDNGDLIQGTPLADYIFEQSGAG
FT                   YLDKQAHPVFKAMNELGYDAGNLGNHEFNYGLDYLTKTLQGAKFPYVNANVFEAGAFKR
FT                   DAKGQIDWSGNKFTPYLLLERKVKDDKGQLQTVKVGILGLTPPQVLQWDKRHLEGKVVV
FT                   ADMVETANHYVPELRAKGADIVVVVAHTGINASSYEAMMENSAWHLAKVKGVDALMLGH
FT                   AHKNFPGDFPDLPEVDNKAGTLSGIPTVMPGYWGNHLGIIDLKLEQVDGKWQVKQSQAS
FT                   LRKIDSSEGSAVDQRVVDLVQADHDATNQWLDEPLGKITSSIHSFFALVQDDPSVQLVS
FT                   DAQRKHAEQLQKDGLLKESYPILSVAAPFRGGRNGINDFTYVAQGDISLRNVSDLYIYP
FT                   NTLQVVEVNGATVKEWLEMSAGQFNQIDTGKTEVQWLVNEKFPTYNFDVIDGVNYEVDI
FT                   TQPARYNKEGAKVSDGQRISSLTFNGQPIDPTQKFYVVTNNYRASGGGHFPGIDGSNIV
FT                   HEDPFETREIIAQYLKAQSADNPAGFSPAANNNWHMKALPANVDVRLYSSPREEAKQLA
FT                   GADLEYKSTLPMDDAQHPGYAIFRLIRQ"
     gtgaataaaa ccatgaagct gggtgctatt gcagccatcg tgctgttatc tgcctgtagc        60
     aatgaaaacg acagcaaggc gcaaccgggt gaggttgccc tgcgtctgat ccagacctcc       120
     gatatccact ccaacgtact gggctacgac tactaccaga acaaggaaga tcgcaagttt       180
     ggcctctctc gcaccgcgct gctgatccgc gcggcccgcg ccgaaaaccc caacaacctg       240
     ctgctcgaca acggcgacct gatccagggc acgccgctgg cggactacat cttcgagcag       300
     tccggtgccg gttacctcga caagcaggcc cacccggtgt tcaaggcgat gaacgagctc       360
     ggctacgatg ccggcaacct gggcaaccac gaattcaact acgggctgga ttacctcacc       420
     aagaccctgc agggggccaa gttcccctat gtgaacgcca acgtgttcga ggcgggcgcc       480
     ttcaagcgcg atgccaaggg gcaaatagac tggagcggca acaagttcac cccctacctg       540
     ctgctggagc gcaaggtgaa ggatgacaag ggccagctgc agaccgtcaa ggtcggtatc       600
     ctggggctga ccccgccgca ggtactgcag tgggacaagc gtcatctgga aggcaaggtg       660
     gtggtggccg acatggtcga gaccgccaac cactatgtgc ccgagctgcg cgccaagggg       720
     gccgacatcg tggtagtggt ggcccatacc ggcatcaacg ccagcagcta cgaggccatg       780
     atggagaact cggcctggca cctggccaag gtgaaggggg tggatgccct gatgctgggc       840
     cacgcccaca agaacttccc gggtgacttc ccggatctgc cggaggtgga caacaaggcc       900
     ggcaccctga gcggcattcc gaccgtgatg ccgggttact ggggcaacca cctcggcatc       960
     atcgacctca agctggagca ggtggacggc aagtggcagg tgaaacagag ccaggccagc      1020
     ctgcgcaaga tcgactccag cgagggcagc gcggtggatc agcgggtggt agacctggtg      1080
     caggccgacc acgacgccac caaccagtgg ctggacgagc cgctcggcaa gatcacctcc      1140
     tccatccaca gcttcttcgc cctagtgcag gatgatcctt cggtgcagct ggtgagcgat      1200
     gcccagcgca agcatgccga gcagctgcaa aaagacggcc tgctcaagga gtcctacccc      1260
     atcctgtcgg tggcggcgcc gttccgtggc ggtcgcaacg gcatcaatga cttcacctat      1320
     gtggcccagg gtgacatctc cctgcgcaac gtctccgacc tctacatcta tccgaacacc      1380
     ctgcaggtgg tcgaggtgaa cggggccacc gtcaaggagt ggctggagat gagtgccggc      1440
     cagttcaacc agatcgacac cggcaagacc gaggtgcagt ggctggtgaa cgagaagttc      1500
     cccacctaca acttcgacgt gatcgatggg gtcaactacg aggtggatat cacccagccg      1560
     gcccgttaca acaaggaagg ggccaaggtc agcgacggcc agcgcatcag cagcctcacc      1620
     ttcaacggtc agcccatcga tccgacccag aagttctacg tggtgaccaa caactaccgc      1680
     gccagcggcg gcggccactt cccgggcatc gacggcagca acatagtgca tgaagacccc      1740
     ttcgagacgc gcgagatcat cgcccagtac ctgaaggccc agtctgccga caaccctgcc      1800
     ggcttcagcc cggcggccaa caacaactgg cacatgaagg ccctgccggc caacgtggac      1860
     gtgcggctct actcctcgcc ccgtgaggag gccaaacagc tggcgggtgc ggatctggag      1920
     tacaagtcca ccctgccgat ggatgatgcc cagcaccctg gctacgccat cttccggctg      1980
     atccgtcagt aa                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page