(data stored in ACNUC7421 zone)

EMBL: CP000462.PE538

CP000462.PE538       Location/Qualifiers
FT   CDS_pept        complement(596295..596750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39403"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR9"
FT                   /protein_id="ABK39403.1"
FT                   /translation="MPAGLTCIKTPSPQVRTMPCMTTHHSHPARPARADKAPVHPRLKR
FT                   EQQTVSAMIRLYCDHHHQDPVCRHCQQLQEFAHQRLRRCRYGHGHKPTCANCHIHCYAP
FT                   AMRKQIQLVMKWSGPRMLWHHPWLALRHLLDSRRKAPKRPGSRPLPP"
     ttgcccgccg gtttgacctg tatcaagacc ccgtcgcccc aggtccggac aatgccctgc        60
     atgacgaccc atcactccca ccccgcgcgc ccggcccgtg ccgacaaggc gcccgtgcat       120
     cccaggctca agcgggagca gcagacggtc agcgccatga tccgcctcta ctgcgaccat       180
     catcatcagg atcccgtctg ccggcactgc cagcagttgc aggagtttgc ccaccagcgg       240
     ctgcgccgct gccgctatgg tcacggccac aagcccacct gtgccaactg ccacatccac       300
     tgctatgccc cggccatgcg caagcagatc cagctggtga tgaagtggag cggcccgcgc       360
     atgctgtggc atcacccctg gctggccctg cgccacctgc tggacagccg ccgcaaggcc       420
     cccaaacgac cgggcagccg tcctctaccg ccctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page