(data stored in ACNUC7421 zone)

EMBL: CP000462.PE539

CP000462.PE539       Location/Qualifiers
FT   CDS_pept        complement(596803..598605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0563"
FT                   /product="aminopeptidase P"
FT                   /note="identified by match to protein family HMM PF00557"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37723"
FT                   /db_xref="GOA:A0KFS0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS0"
FT                   /protein_id="ABK37723.1"
FT                   /translation="MNHFEIIETRVAQVRAELAMMELDAFIVPHDDEHLGEYIPAYAER
FT                   LDWITGFNGSAGLAIILAQRAALFIDGRYTVQARMQAPAELFEFLHLVEDPHVQWLADQ
FT                   LPSGSRVGFDARLHSLAWYHNAKAVLTERGIELVRVEQNPIDLHWSDRPAPTKNPAILY
FT                   SEALAGQSSQAKREMLASDLRKRGLDAVLLTQAEPINWLLNLRGRDVERLPVVLGFAVL
FT                   YANATMDFFVDTDKIDCFAFSQHVGQDVSVYPIDKLGDVLQRIGEDQQKVLADPNTANA
FT                   WTQLVMEEAGAILVAGQDPTMLPKACKNEVELAGMRAAHLRDGVAVTRFLAWLDRLIAS
FT                   GEFDGVDEGTLADQLEAFRREQEHYVEPSFDTISALGPNAAMCHYRHTNGTPRTFGQDS
FT                   IYLVDSGAQYLDGTTDITRTLKVGELTDEHKAMFTRVLQGHIALDQARFPRGTAGIQLD
FT                   VLARQPLWQAGYNYDHGTGHGVGHFLSVHEGPQRIAPKGSLVALQPGMVLSNEPGYYRE
FT                   DAFGIRCENLVVVTEQEQIGELPMLGFERLTYVPFDTRLIDRSLLSPAEFRWINEYHAE
FT                   VYRRLSPLLEGEDLAWLEQATSLI"
     atgaatcatt tcgagattat tgaaacccgc gtcgcccagg tcagggccga actggccatg        60
     atggagctgg acgccttcat cgtcccccac gacgacgagc acctggggga gtacattccc       120
     gcctacgccg agcgactgga ctggatcacg ggtttcaacg gctccgccgg cctcgccatc       180
     atcctggcgc agcgggcggc cctgttcatc gacggtcgtt acacggtgca ggcccgcatg       240
     caggcaccgg ccgagctctt cgagtttctc catctggtgg aagatcccca tgtgcagtgg       300
     ctggcggatc agctgccgtc cggctcccgg gtcggcttcg acgcccgcct gcacagcctg       360
     gcctggtatc acaatgccaa ggcggtgctg accgagcgcg gcatcgagct ggtgcgggtg       420
     gagcagaacc ccatcgatct gcactggagc gatcgccccg cccccaccaa gaacccggcc       480
     atcctctaca gcgaagcgct ggcgggccaa tccagccagg ccaagcgcga gatgctggcc       540
     agcgatctgc gcaagcgcgg gctggatgca gtgctgctga cccaggccga gcccatcaac       600
     tggctgctca acctgcgtgg tcgcgacgtg gagcggctac cggtggtgct gggcttcgcg       660
     gtgctctacg ccaacgccac catggatttc ttcgtcgaca ccgacaagat cgactgcttc       720
     gccttcagcc agcacgtggg gcaggatgtc tccgtctacc ccatcgacaa gctgggtgac       780
     gtgctgcagc gcatcggtga agaccagcag aaggtgctgg ccgatcccaa caccgccaac       840
     gcctggaccc agctggtcat ggaagaggcg ggcgccatcc tggtggccgg tcaggacccg       900
     accatgctgc ccaaggcatg caagaacgag gtggagctgg ccggcatgcg cgccgcccat       960
     ctgcgcgacg gtgtcgccgt cacccgcttc ctggcctggc tggatcggct gatcgccagc      1020
     ggcgagttcg acggggtgga tgaagggacc ctggccgatc agctggaagc cttccgccgc      1080
     gagcaggagc actacgtcga gccgagcttc gacaccatct cggcgctcgg ccccaacgca      1140
     gccatgtgtc actaccgcca caccaacggc accccgcgta cctttggcca ggacagcatc      1200
     tatctggtgg actccggcgc ccagtatctg gacggcacca ccgacatcac ccgtaccctc      1260
     aaggtgggtg agctgaccga cgagcacaag gcgatgttca cccgggtact gcagggtcac      1320
     atcgcgctgg atcaggcccg cttcccgcgc ggcaccgccg gcatccagct cgacgtgctg      1380
     gcccgccagc cgctgtggca ggccggttac aactacgacc acggcaccgg ccacggcgtc      1440
     ggccacttcc tgagcgtgca cgaaggcccg cagcgcatcg cccccaaggg cagcctggtg      1500
     gccctgcagc cgggcatggt gctctccaac gaacctggct actaccggga agatgccttc      1560
     ggcatccgtt gcgagaacct ggtggtggtc accgagcagg agcagatcgg cgagctgccg      1620
     atgctcggct tcgagcggct gacctatgta ccgttcgata cccgcctcat cgatcgcagc      1680
     ctgctgagcc cggccgagtt ccgctggatc aacgagtatc acgccgaggt ctaccgccgc      1740
     ctgagcccgc tgctggaagg cgaggatctc gcctggctgg agcaggcaac cagcctcatc      1800
     taa                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page