(data stored in ACNUC7421 zone)

EMBL: CP000462.PE540

CP000462.PE540       Location/Qualifiers
FT   CDS_pept        complement(598639..599304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0564"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37245"
FT                   /db_xref="GOA:A0KFS1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS1"
FT                   /protein_id="ABK37245.1"
FT                   /translation="MTPPYKTRTQMVMENLRGRILRGEFPAGAPLRQDAIAKELAVSRI
FT                   PVREALMQLEAQGLVKFEAHRGAVVTMLDAAAIEELFYLRALLEADTLFHAVDLMTEET
FT                   FARAQAILAQFDQALESGTQIERWAELNHSFHATLYQAAGRPQALELIAQINLSCDRYV
FT                   RFELLFASDGVDKAEREHAQLLELCRARRKHEAVVLLKQHIEAAGQSIKRILDSGHNH"
     atgaccccac cctacaagac ccgaacccaa atggtgatgg aaaacctccg tggccggatc        60
     ctgcgcggtg agtttcccgc cggcgccccc ctgcgtcagg acgccatcgc caaggagctg       120
     gcggtgagcc gcattccggt gcgggaagcc ctgatgcagc tggaagcgca ggggctggtg       180
     aagttcgagg cacaccgcgg cgccgtggtc accatgctgg acgcagcggc catcgaggag       240
     ctcttttatt tgcgagccct gctggaagcc gataccctgt tccacgccgt cgacctgatg       300
     acggaggaga ccttcgccag ggcgcaggcg atcctcgccc agttcgacca ggccctcgag       360
     tcgggcaccc agatcgaacg ctgggccgag ctgaaccaca gttttcacgc caccctctat       420
     caggccgccg gccgccccca ggcactggag ctgatcgccc agatcaatct gagctgtgac       480
     cgctatgtgc gcttcgagct gctgttcgcc agcgatggcg tcgacaaggc cgagcgcgag       540
     cacgcccagc tgctggagct gtgccgcgcc cgccgcaagc acgaggcggt ggtactgctc       600
     aagcaacata tcgaggcggc tggccagtcc atcaagcgga tcctggacag cggccacaac       660
     cactga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page