(data stored in ACNUC7421 zone)

EMBL: CP000462.PE543

CP000462.PE543       Location/Qualifiers
FT   CDS_pept        complement(602248..602838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0567"
FT                   /product="heat shock protein 15"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35955"
FT                   /db_xref="GOA:A0KFS4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS4"
FT                   /protein_id="ABK35955.1"
FT                   /translation="MFINIFWHPNRLAIVYGNGPRDNRPDGMKLRKLTFRHTISPPVSI
FT                   PGPASGIIRHPFQPFRSRFMPNPAETPALVRLDKWLWAARFYKTRSLARDQIEGGKVHY
FT                   NGQRSKPGKHVEVGALIRFWQGQDEREVRVLEVSEQRKSAPLAQQLYEETEASLKKRAE
FT                   NSEARRFNSQFAPSPERRPDKQERRQLIKVKQY"
     atgtttatca atattttctg gcatccaaat cggttggcta ttgtgtacgg caatggaccc        60
     agagacaacc gaccggatgg gatgaagctg cgaaaattga cattccgtca caccatcagc       120
     ccccctgttt ctatcccggg gcccgcctct ggtataatca ggcacccctt tcagccattc       180
     cggagtcgat tcatgccgaa ccccgcagaa accccagccc tggtccgtct cgacaagtgg       240
     ttgtgggcgg cacgttttta caagacccgc agcctggccc gcgaccagat tgaagggggc       300
     aaggtgcatt acaacggcca gcgcagcaaa ccgggcaagc atgtcgaggt cggcgctctc       360
     attcgcttct ggcagggtca ggacgaacgg gaagtgcggg tgctcgaggt gagcgagcag       420
     cgcaagtccg ccccgctggc ccagcagctc tatgaagaga ccgaggccag cctgaaaaag       480
     cgggccgaaa acagcgaggc acgccgcttc aacagccagt ttgcgccaag ccccgagcgt       540
     cgccccgaca agcaggagcg gcgccagctg atcaaggtca agcaatattg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page