(data stored in ACNUC7421 zone)

EMBL: CP000462.PE55

CP000462.PE55        Location/Qualifiers
FT   CDS_pept        complement(62289..63905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED7"
FT                   /protein_id="ABK37902.1"
FT                   /translation="MNPAYKWLLAMVIATSWASQASAAVIKYNLVDADLRHFLFIENQE
FT                   DHNLFITPTDYLDPRLTGGNAWTTDSRQVSLAYADNGHNYTVTNYNIDMWENGPVKYPY
FT                   INQRCIKSWAGCDPQTAEAMNKPASVNETGFFGLMKAATGYAHAKLSSAFFGYLRTMPA
FT                   GGILNREMNLCMTTRIYDAAAGERCINQDSGTWYVKRTQHKKAGHLRFIQTNAISEVIV
FT                   DSNGAPYVLPGSQGCENYRLGTRDGVLCRFLDYDFNQDGSQSFSDPYIYTNIKNAALNS
FT                   AIVGGDVQMSANLTNWALKGADYNVSYLRGQSSIYLFLSSNFFKQVVRLGLQEQLTRNL
FT                   INFNMRNIKAPESGFYEFSGTTEIIIKPRDFSVSILSSEGVSNPYREGNVGKDILSFSY
FT                   NISDSGPISADMLEITVSQDIGAPYQGLCTFYPAGQAVPEQAVPIPTRLVFDSTNHGTA
FT                   SRHAVRCDQTPLDIRTLGIQDSQPPQEWNDPVSGKSITRFYKLALEFDLTDPMVQRTIG
FT                   NDLWEGEVQQSGTITIKGTWR"
     atgaatcccg catataaatg gctgttggcg atggtaattg ccaccagctg ggcctcgcag        60
     gccagtgccg cagtaataaa atataatttg gtcgatgctg atctgcgcca ttttctgttt       120
     attgaaaacc aggaagacca caatctattt attacaccaa ccgattatct ggacccacgc       180
     ctgacgggtg gcaatgcatg gacaactgac tccaggcagg tcagtttggc atatgcagac       240
     aatggtcata actacacagt caccaactac aacatcgata tgtgggaaaa cggcccggtt       300
     aaatatccgt atatcaatca gcgttgcata aaaagctggg ctgggtgtga cccacagaca       360
     gcagaagcga tgaataaacc cgcctcagta aatgaaaccg gatttttcgg attgatgaag       420
     gccgccaccg gatatgcaca tgcaaaattg agctccgctt tctttggcta tcttcgcacc       480
     atgcctgccg ggggcatttt gaaccgagag atgaatcttt gcatgaccac cagaatctat       540
     gatgccgcgg ccggggaacg ctgtatcaat caggatagtg ggacctggta cgtcaagcgg       600
     acccagcata aaaaagcggg acacctacgt ttcatacaaa ccaatgcgat cagtgaagtg       660
     atcgtcgaca gcaatggagc tccctatgtg ctgcccggtt cacaaggttg tgagaattat       720
     cggctgggta cacgagatgg agtgctgtgc cgctttctcg actacgactt caatcaggat       780
     ggcagccagt cattttcaga cccgtatatt tataccaaca tcaaaaatgc ggcactcaac       840
     agcgccattg ttggcggtga tgtacaaatg agtgcgaatc tgaccaactg ggctcttaaa       900
     ggtgcggatt acaatgtcag ctatcttaga gggcaatcgt ccatttatct ttttctatca       960
     agcaactttt tcaaacaagt ggtcaggttg ggattacaag aacagctcac cagaaatttg      1020
     attaacttta atatgcgaaa tatcaaagcg ccggaaagtg gattctatga attcagcggc      1080
     accaccgaga tcattataaa accacgggac ttcagtgttt ccattctatc ctcggagggg      1140
     gtgagcaatc cctaccgaga aggcaatgtg ggcaaggata tattgagttt ctcttacaat      1200
     atctcggata gtgggcccat cagtgcagac atgcttgaga ttaccgtttc acaagatatc      1260
     ggggctccgt atcaaggtct ctgcactttt taccccgcag ggcaggctgt tcccgaacag      1320
     gcagtaccta taccgacgag attggtattt gattcgacca accatgggac agcctcccga      1380
     catgcggtcc gctgtgatca gacgccgctg gatattcgta ccttggggat tcaggacagc      1440
     caacctccac aggaatggaa tgaccccgtc agcggcaaaa gcattacccg attctacaag      1500
     ctggcactgg aattcgatct gaccgatccc atggtgcaac gcaccattgg caacgacctg      1560
     tgggaagggg aagtacagca aagcggtacc attaccatca aaggaacctg gcgctga         1617
//

If you have problems or comments...

PBIL Back to PBIL home page