(data stored in ACNUC7421 zone)

EMBL: CP000462.PE558

CP000462.PE558       Location/Qualifiers
FT   CDS_pept        complement(616925..617593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0582"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39071"
FT                   /db_xref="GOA:A0KFT9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT9"
FT                   /protein_id="ABK39071.1"
FT                   /translation="MPTPLPWHQIDTVLLDMDGTLIDLHFDNHLWQQLVPERYAERLGL
FT                   PLAEARVQIEAHYQAVSGTLNWYCVDYWSETLGLDIRALKQESLAKIQWRPHVIPFLAA
FT                   LRAAGKQLVLFTNAHPASLSVKDAQLGLAGHLDLMVSTHELGWSKESQHCWQALAERLA
FT                   FDPARTLFVDDSERILRAAADYGIGYQLAIQNPDSCQPEQHITAFPAIRDYAELLPLAE
FT                   "
     atgccgaccc cactgccctg gcaccagatt gacactgtcc tgctcgatat ggatggcacc        60
     ctgatcgatc tccattttga caaccacctc tggcagcagc tggtacccga gcgctatgcc       120
     gagcgactcg gcctgccgct ggccgaggcc agagtgcaga tcgaggcgca ctaccaggcc       180
     gtcagcggca ccctcaactg gtactgcgtg gattactgga gcgagacgct ggggctcgac       240
     atccgtgccc tcaagcagga gagcctggcc aagatccagt ggcggcccca cgtcatcccc       300
     ttcctggccg cgctgcgggc cgcgggcaag cagctggtgc tgttcaccaa tgcccacccc       360
     gccagcctgt cggtgaagga tgcgcagctg gggctggccg gccacctgga tctgatggtg       420
     agcacccacg agctgggctg gtcgaaggag agccagcact gctggcaggc actggccgag       480
     cggctggcat tcgacccggc ccgcactctc tttgtagatg acagcgagcg gatcctgcgc       540
     gccgccgccg attacggcat cggctatcag ctcgccatcc agaacccgga cagttgccag       600
     cccgagcaac acatcaccgc cttcccggcg atccgtgatt acgccgagtt gctgccgctg       660
     gccgagtaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page