(data stored in ACNUC7421 zone)

EMBL: CP000462.PE56

CP000462.PE56        Location/Qualifiers
FT   CDS_pept        complement(63908..66385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36686"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED8"
FT                   /protein_id="ABK36686.1"
FT                   /translation="MPKSETMVRDMLKKTCLLPLSLLMVVSASANSAAPLKIANVIIPA
FT                   SFAQALAEGLAVPVRLQYTDEKNRLDTLTDNPIGNATLLLQDGKLHLLHIDFGAGQQQG
FT                   LLNDQLTAMLASEEKRTFSAEGSLQIDANASMQLDLVAMLLTIRVSRDAFGQARQPDNR
FT                   VTLTPTVDTLTGVHRYNLGYSFNSNRQNGHSDSNFLQLDSTVGMGAHHMALDASLYNLG
FT                   EPEQSGDIYRAMYERDLDDRRIAAGMVSTWDLQTLGVVTGLSTGRIYGASYGNQAQSRK
FT                   QKADTSTTPVQVFMPANGEVRVYREDRLISLQNLAIGNQNIDTSAFPSGVYNVTVEVYV
FT                   DGRLTSTTTQRVTKLGGSLGFTQEWGWQWWGGMMEGAQNNGDSPLLGVSLARSLDTLEL
FT                   ATTTYAFKDAAVGEARANWQATDRVSAQLQTMLASDQSWRFASSLALQAHDNASLWLSQ
FT                   EKLETGSALTVSNAELYSAGITLNLGGWVSGLGQLTFNTLHDRQMNSDRSYADYYQHLY
FT                   AGKYGNLSLRASLQSDSGTLNGFNNKSITLDYSIPFDNLFSFGMSSNEQGQTTANVNYQ
FT                   KRMDGVINLASFNASRMMHGSDEHNMALSGTLGFENRVIGGTMTLGRGHGGDMNGNLIA
FT                   RGALVTTEDALVASSRSSSGAGLIINTGIDRQGQMLAKVNGQDYPLHGEQTFLALPPYG
FT                   EYEIELLNSKRGKDSYDINTGKQRYTLFPGNVATLDASSTIKEMVTVFGILRAEDGSLL
FT                   ANARIDNHIGTTVTNEEGEFSLDVDKANPMLTFRQGNDFCEAELDLEKYSGAAWVGIIT
FT                   CQGLPTYAMVREY"
     ttgccgaaat ctgaaaccat ggtgcgtgat atgttgaaga aaacctgctt gttgccgctc        60
     tcattgctga tggtggtctc cgcctcggcc aacagcgcgg cgccactcaa gatcgccaac       120
     gtcatcattc cggccagttt tgcccaggct ctggcagaag ggctggccgt tcccgttcgt       180
     ctgcagtaca cggatgaaaa aaaccggctc gacaccctga ccgataaccc gatcggcaat       240
     gccaccctgc tgctgcagga cggcaagctg catctgctgc acatcgattt tggtgctggc       300
     cagcagcaag gtctgctcaa cgaccagctg accgccatgc tcgccagtga agagaagcgc       360
     acgttttctg ccgagggcag cttgcagata gatgccaacg ccagcatgca gcttgacctg       420
     gtggccatgt tgctgacgat tcgggtttca cgcgatgcat ttggccaggc caggcagccg       480
     gacaaccggg tgaccttgac cccgaccgtc gacactctga ccggggtgca tcgctacaat       540
     ctgggctact ccttcaacag caatcggcaa aacggtcaca gcgactccaa cttcctgcaa       600
     ctggacagta ccgtcgggat gggcgcccat cacatggcgc tggacgcctc cctctacaac       660
     cttggggagc cagaacagag cggtgacatc tatcgtgcca tgtacgagcg ggatcttgac       720
     gatcgccgca tcgcggccgg catggtctcg acctgggatc tgcagacgct gggggtggtg       780
     accggcctga gtactggccg aatttatggg gcatcgtatg gcaaccaggc ccagtcacgt       840
     aaacagaaag ccgacacatc caccactccg gtacaagtct tcatgcctgc caatggcgag       900
     gtcagggtgt accgtgagga tcgcctgatc agcctgcaga acctggccat cggcaaccag       960
     aatatcgaca cctcggcgtt ccccagtggc gtctacaacg tcacggtcga agtctatgtc      1020
     gatggacggc tgaccagcac cacgacccag cgcgtcacca agctgggcgg cagtctgggc      1080
     tttactcagg agtggggatg gcaatggtgg ggaggcatga tggaaggcgc ccagaacaac      1140
     ggcgattcac cgctgctggg agtatcgctg gcacgttcgc tggataccct ggagctggcc      1200
     accacaacct atgccttcaa ggatgctgcg gtaggcgaag cccgtgcaaa ctggcaggca      1260
     accgatcgtg tcagtgccca gttgcaaacc atgctggcct ccgaccaatc gtggcgcttc      1320
     gcatccagcc ttgccctgca ggcccatgac aatgcctctc tttggctcag ccaggagaaa      1380
     ctcgagaccg gcagcgccct gacggtaagc aacgccgaac tctactctgc cggcatcacg      1440
     ctcaatctgg gtggctgggt cagcggtctc ggccagctca ctttcaacac cctgcacgac      1500
     cgccagatga acagcgatcg cagctatgcc gattactacc agcaccttta tgccggcaaa      1560
     tacggcaacc tgtcactgcg cgccagcctg cagagcgaca gcggtacgct caacggattc      1620
     aacaacaaga gcatcacgct ggattactcg atcccgttcg acaacctgtt cagctttggc      1680
     atgagcagca acgagcaggg ccagaccacg gccaacgtca actaccagaa acgcatggac      1740
     ggcgtcatca atctggcctc gttcaatgcc tcgcgcatga tgcacggcag tgatgaacac      1800
     aatatggcgc tctccggcac actcgggttc gagaacaggg tcatcggcgg caccatgaca      1860
     ttgggccgcg gccatggtgg cgacatgaat ggcaacctga ttgcgcgcgg cgccctggtc      1920
     acgacggagg acgcactggt cgcctcgagt cgcagctcct cgggggccgg cttgatcatc      1980
     aataccggga tcgatcgcca aggacagatg ctcgccaagg tcaacggaca ggattacccc      2040
     ctgcatggcg agcagacctt cctcgccctc cccccttacg gggagtacga gatagagctg      2100
     ctcaacagca agcggggcaa ggacagctac gacatcaata ccggcaagca gcgctacacc      2160
     ctgtttcccg gcaacgtggc caccctggat gcgagcagca ccatcaagga gatggtgact      2220
     gtcttcggca tactcagggc ggaagacggc tccttgctgg ccaatgcccg catcgacaac      2280
     catatcggca ccacggtgac caacgaggag ggtgaattct cgctggatgt ggataaagcc      2340
     aatcccatgc tgactttccg ccaagggaat gacttctgtg aagccgagct agatcttgaa      2400
     aaatacagcg gcgccgcctg ggtaggcatc attacctgcc aggggctgcc cacctatgcc      2460
     atggtgagag agtactga                                                    2478
//

If you have problems or comments...

PBIL Back to PBIL home page