(data stored in ACNUC7421 zone)

EMBL: CP000462.PE561

CP000462.PE561       Location/Qualifiers
FT   CDS_pept        619602..620873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0585"
FT                   /product="serine transporter"
FT                   /note="identified by match to protein family HMM PF01490"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36559"
FT                   /db_xref="GOA:A0KFU2"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU2"
FT                   /protein_id="ABK36559.1"
FT                   /translation="MSLSVDVTKELSGSCSTTVSATPWRRHDTHWVISLFGTAVGAGIL
FT                   FLPINLGLGGIWPLIIVSVLAGPMTFLAHRGLARFVLSSSRPHADFTEVAQEHFGKMAG
FT                   RLISALYFLSIFPILLIYGVGLTNTVESFMINQLGMDAPNRVMLSGLLVFAMIAVMLAG
FT                   EKAMLRAFAVMVYPLAAILAALSCYLIPQWQWPQLGSLEGGSFLNTVWLALPVTVFAFS
FT                   HAAAISGFANVQRREYGELAEAKSSLILRNTTVMLVGFVLFFVFSCVLSLSPAQLAEAK
FT                   AQNVSVLSYLANITDNPVIVTLGPLIAFIAISSSFLGHFLGARESLKSLIAKPTGLSLA
FT                   KADRLGIALMFFSIWGAAIINPGILGLMETLSGPVIAMILFIMPVVAIYKVEALARFRH
FT                   RWANGFILLTGALAVSALIFSLLK"
     atgagtttat ctgtagacgt caccaaggag ctgtccggtt cctgctccac caccgtcagc        60
     gccaccccct ggcgtcgcca cgacacccac tgggtcatca gcctgtttgg taccgccgtc       120
     ggcgccggca tcctgtttct gcccatcaat ctgggtctgg gcgggatctg gcccctcatc       180
     atcgtctccg tgctggccgg tcccatgacc ttcctggccc accgcgggct ggcgcgcttc       240
     gtgctttcct cttcgcgccc ccacgccgac ttcaccgagg tggcccagga gcacttcggc       300
     aagatggccg gccgcctcat ctcggcgctt tacttcctct ccatcttccc gatcctgctc       360
     atctacgggg tcgggctgac caacacggtg gagagcttca tgatcaatca gctcggtatg       420
     gatgccccga accgggtgat gctctccggt ctgctggtgt tcgccatgat cgccgtgatg       480
     ctggccggcg agaaggcgat gctgcgtgcc tttgccgtca tggtctatcc gctggcggcc       540
     atcctggcgg cgctctcctg ctacctgatc ccccagtggc aatggccgca gctgggcagc       600
     ctggagggcg gcagcttcct caacaccgtc tggctggcgc tgccggtcac cgtgttcgcc       660
     ttcagccacg ccgccgccat ctccggcttt gccaacgtgc agcgccggga gtacggcgag       720
     ctggcggaag ccaagagcag cctgatcctg cgcaacacca ccgtgatgct ggtgggcttc       780
     gtgctgttct tcgtcttctc ctgcgtgctg agcctctcgc cggcccagct ggccgaggcc       840
     aaggcccaga acgtctcggt gctctcctac ctcgccaaca tcaccgacaa tccggtgatc       900
     gtgaccctgg ggccgctcat cgccttcatc gccatcagct cctccttcct cggccacttc       960
     ctcggggccc gtgagagcct gaaaagcctg atcgccaagc ccaccggcct gtcgctggcc      1020
     aaggcggacc ggctcggcat cgccctgatg ttcttctcca tctggggcgc cgccatcatc      1080
     aaccctggga tcctggggct gatggagacc ctctccggcc cggtgatcgc catgatcctg      1140
     ttcatcatgc cggtggtggc catctacaag gtggaggcgc tggcccgctt ccgccaccgc      1200
     tgggccaacg gcttcatcct gctgaccggc gcgctggcgg tgtcggcgct gatcttcagc      1260
     ctgctgaagt aa                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page