(data stored in ACNUC7421 zone)

EMBL: CP000462.PE566

CP000462.PE566       Location/Qualifiers
FT   CDS_pept        623853..626321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0590"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase II (akii-hdii)"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF00742; match to protein
FT                   family HMM PF03447; match to protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39637"
FT                   /db_xref="GOA:A0KFU7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU7"
FT                   /protein_id="ABK39637.1"
FT                   /translation="MEQQQQGEIAVATEAGLKRRHVHKFGGSSLADPVCYRRVASILEQ
FT                   QAEQQGGGRELVVVSAAGKTTNRLIQLVELAEAGDEAAGEAISALQAYQQSLIDGLLEG
FT                   ELHLELSQQLADDMQLIAKTLEGQFDRFERNGLLAFGEVWSARLLAALLTSRGDKAIWL
FT                   DARSFLRAEDGALVKVDTALSSELLKARLAEHAGRIVVTGFIAADMEGRSLLLGRNGSD
FT                   YSASLLALLADGESTTIWSDVAGVYSADPRRVKEARLLERLSLAEANELARLGSSVLHS
FT                   RTLQPVADSRQRLTLRCSYNPDEGCTHILRRAPRSGGARIVSSVDQIALIELKVLPQTH
FT                   YEQTVAAIEAHLARHRLNPLTLQRQPDRRILRLAYTLEVAQGAFELLRDFQLQGSFTGL
FT                   IQREGYSLVALVGAGVTDNAEQCHRFYQLLADQPLEFVQVAKDGLSLVAVLRQVVLEPL
FT                   LIALHSALFSRPNRVGLVVFGKGNIGGHWLNLYAREKARLEHELNLALTLYGVFSSEGG
FT                   LLDEEGLDPLKVQDNFNPKPLIWPELLAQLEQHGFDTLIALDMTASETVSRYYPDFAQL
FT                   GIHIIAANKFAGAADSEFYQRIKQTCRDHQVQWRYNATVGAGLPIQSSIQMLRQSGDRI
FT                   QGVSGIFSGTLSWLFQQYDGSRPFSELVDEAWQHGLTEPDPREDLSGQDVRRKLLILAR
FT                   EAGFELDSADIELENLVPVSLRKVSTDQFMDRLKDLDDPIQTAFEGARRVGKVLRYVAR
FT                   FEHDGKARVGLEALEPHHPFANLLPCDNIFAIESDSYRTNPLVIQGPGAGREVTAAAIQ
FT                   YDLWQICASL"
     atggaacagc agcaacaagg agagatcgcg gtggcaacag aagcaggctt gaagcgacgt        60
     cacgtccaca aattcggtgg cagcagtctg gcggatccgg tctgttatcg ccgggtcgcc       120
     agcattctcg aacaacaagc cgagcagcag gggggcggac gagagctggt ggtggtctcc       180
     gccgccggca agactaccaa ccggctgatc cagctggtgg agctggccga agccggcgat       240
     gaagccgccg gcgaggccat ctcggctctg caggcctatc agcagagcct gatcgacggc       300
     ctgctggaag gggaactcca cctcgagctg agccagcagc tggccgacga catgcagctg       360
     atcgccaaga cgcttgaggg gcagtttgac cgcttcgagc gcaacggcct gctcgccttt       420
     ggcgaggtgt ggtcggcgcg cctgttggcg gccttgctca ccagtcgcgg cgacaaggcc       480
     atctggctcg atgcccgcag cttcctgcgc gccgaggatg gcgccctggt caaggtggat       540
     accgcgctgt ccagcgaact gctcaaggcg cggctggcgg aacacgccgg gcgcatcgtg       600
     gtgaccggct ttatcgccgc cgacatggag ggtcgctcct tgctgctcgg tcgcaacggc       660
     tccgactaca gcgccagcct gttagccctg ctggcggacg gcgaatccac caccatctgg       720
     agcgacgtgg ccggggtcta cagcgccgac ccgcgccggg tgaaagaagc gcgcctgctg       780
     gagcgcctga gcctcgccga agcgaacgag ctggcccgcc tcggctcctc ggtattgcac       840
     tcgcgcaccc tgcagccggt ggccgacagc cgccagcgcc tcactctgcg ctgcagctac       900
     aacccggacg agggctgcac ccatatcctg cgtcgcgccc cccgctccgg cggcgcccgc       960
     atcgtctcct cggtggatca gatcgccctc atcgagctca aggtgctgcc gcagacccat      1020
     tatgagcaga cggtggcagc catcgaggcc catctggccc gccatcgcct caacccactc      1080
     accctgcagc gccagccgga tcgccggatc ctgcgcctcg cctacaccct cgaggtggcg      1140
     cagggggcgt tcgagctgct gcgcgacttc cagctgcagg gcagtttcac cggtcttatc      1200
     cagcgtgaag gctacagcct ggtggcgctg gtgggggctg gcgtcaccga caacgccgag      1260
     cagtgccacc gcttctacca gctgctggcg gatcagccgc tggagttcgt gcaggtggcc      1320
     aaagacggcc tgagcctggt ggccgtgctg cgccaggtgg tgctggagcc cctgctgatc      1380
     gccctgcaca gcgccctgtt cagccgcccg aaccgggtcg gtctggtggt gttcggcaag      1440
     ggcaacatcg gcggtcactg gctcaacctc tatgcccgcg agaaggcgcg gctcgagcat      1500
     gaactgaacc tggcgctcac cctctacggg gtgttcagct cggaaggggg cctgctcgat      1560
     gaagaggggc tggatccgct caaggtgcag gacaacttca accccaagcc gctgatctgg      1620
     cccgagctgc tggcccagct ggagcagcac ggcttcgata ccctgattgc gctggacatg      1680
     accgccagcg agacggtgag ccgctactac ccggactttg cccagctcgg cattcacatc      1740
     atcgccgcca acaagtttgc cggtgccgcc gacagcgagt tctaccagcg catcaagcag      1800
     acctgccgcg accatcaggt gcagtggcgc tacaacgcca ctgtcggtgc cgggctgccg      1860
     atccagtcca gcatccagat gctgcgccag agcggcgacc gcattcaggg ggtctccggc      1920
     atcttctccg gcaccctctc ctggctgttc cagcagtatg acggcagccg ccccttctcc      1980
     gagctggtgg acgaggcgtg gcaacatggc ctgaccgagc cggatccccg cgaggatctc      2040
     tccggccagg atgtgcgccg caagctgctg atcctggcgc gggaggcggg cttcgagctc      2100
     gactccgccg acatcgagct ggagaacctg gtgcctgtct ccctgcgcaa ggtgagcacg      2160
     gatcagttca tggacaggct caaggatctg gatgacccga tccagaccgc cttcgagggg      2220
     gcgcgccgag tcggcaaggt gctgcgctac gtcgctcgct tcgagcacga cgggaaggct      2280
     cgagtggggc tggaggcgct ggagccccac cacccgttcg ccaacctgct gccgtgcgac      2340
     aacatcttcg ccatcgagag cgacagctat cgcaccaacc cgctggtcat ccaggggccg      2400
     ggcgccggtc gggaagtgac ggccgcagcc atccagtacg atctctggca gatctgtgcc      2460
     agcctgtaa                                                              2469
//

If you have problems or comments...

PBIL Back to PBIL home page