(data stored in ACNUC7421 zone)

EMBL: CP000462.PE57

CP000462.PE57        Location/Qualifiers
FT   CDS_pept        complement(66437..67102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39283"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED9"
FT                   /protein_id="ABK39283.1"
FT                   /translation="MNLKMLLAWMLFIPGVSQAINVGSVTTFIDAGSQDVAKEIENGSA
FT                   QARLVTISVSRISSPEEGGQEIPMEVAGELMLSPSRLMLPAHAKNNVRFFYKGPQDGKE
FT                   RYYRIRWLDTALSMDDQSNNRRQAVATTSAQIGTILVVTPRQQHFAYNLQNGMLSNQGN
FT                   ASYRTVAYGPCLDRKAQAQCKETYYDLPGKQRRFKKVDMQDPQSHLGLWLGQEFVVVK"
     atgaacctga aaatgctgtt ggcatggatg ctgtttattc ccggggtcag ccaggccatc        60
     aacgttggtt ccgtcaccac cttcatcgat gcgggcagcc aggatgtagc caaggagatc       120
     gagaatggca gtgctcaagc caggctggtc accatctccg tcagccgcat ctcttcacct       180
     gaagagggtg gccaggagat cccgatggaa gtggccggcg agctgatgct ctcgcccagc       240
     cgactgatgc tgcccgccca tgccaagaac aacgtgcgtt tcttttacaa gggaccgcag       300
     gacggcaagg agcgctacta ccgcatccgc tggctggaca cagccctgtc gatggacgac       360
     cagagcaaca atcgtcgcca ggcggttgcc accacctctg cccagatagg caccattctg       420
     gtggtcacgc cacgccagca gcacttcgcc tacaacctgc aaaacggaat gttgagcaat       480
     caggggaatg cctcttaccg caccgtggcc tacggcccct gtctggaccg caaggcacag       540
     gcgcagtgca aagagaccta ctacgacctg cccggcaagc agcgccgctt caagaaagtc       600
     gatatgcagg atccacaaag tcatcttggc ctctggctgg gtcaggaatt cgtcgtcgtc       660
     aaataa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page