(data stored in ACNUC7421 zone)

EMBL: CP000462.PE575

CP000462.PE575       Location/Qualifiers
FT   CDS_pept        complement(638445..638906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0599"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37374"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV6"
FT                   /protein_id="ABK37374.1"
FT                   /translation="MIAISTLLPLASLALKLGSKLLGDGTPQAKAETPVQEERLAPTVQ
FT                   SLFQRLGVKDANSEQSRPAINHFMGALMQTLGQEYSGQSLPQAIDAARTQLADGTQSTR
FT                   LDALQSELDTLKDSLGASNLNLDQLLGAFKQTLPNGKGEGVGRMLNTSV"
     atgatcgcca tcagcaccct gcttcccctc gcctcccttg ccctcaagct cggcagcaag        60
     ctgctcggcg atggcacgcc acaggccaag gccgaaactc ccgtgcagga agagcggctc       120
     gcccccacgg tgcagagcct gttccagcgg ctgggagtca aggatgccaa cagcgagcag       180
     agccgccccg ccatcaacca cttcatgggg gcgctgatgc agaccctggg tcaggagtac       240
     tcaggccagt ccttgcccca ggccatcgac gccgcccgca cccagctggc tgacggcacc       300
     cagagcaccc gcctcgatgc gctacaaagc gagctcgaca ccctcaagga ttccctcggc       360
     gccagcaatc tcaatctcga ccagctgctc ggtgccttta aacagaccct gcccaatggc       420
     aagggggagg gggttggcag gatgcttaat accagtgtat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page