(data stored in ACNUC7421 zone)

EMBL: CP000462.PE576

CP000462.PE576       Location/Qualifiers
FT   CDS_pept        complement(639107..639379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0600"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38703"
FT                   /db_xref="GOA:A0KFV7"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV7"
FT                   /protein_id="ABK38703.1"
FT                   /translation="MRQQKASRLFSRLFIGKESLMTMWTGIVLIVFISALFGFLSKRAR
FT                   YQLGDIRITDRLGKQDVLINQLQERIANLEAIVIEEEKRRPFKEL"
     atgagacaac agaaggcaag caggctgttt tctcgtttgt tcatcggcaa ggagtcactc        60
     atgaccatgt ggaccggtat cgtgctgatc gtcttcatca gcgcactgtt cggctttctc       120
     agcaagcggg cccgctacca gctgggggat attcgcatca ccgaccgcct cggcaaacag       180
     gacgtgctca tcaaccagct gcaggagcgc atcgccaatc tggaggccat cgtcatcgag       240
     gaggagaagc gccgcccatt caaggagctc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page