(data stored in ACNUC7421 zone)

EMBL: CP000462.PE577

CP000462.PE577       Location/Qualifiers
FT   CDS_pept        complement(639428..639769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0601"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF06961"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39232"
FT                   /db_xref="GOA:A0KFV8"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV8"
FT                   /protein_id="ABK39232.1"
FT                   /translation="MIWLALLPLLWTAWLGLADANWWPLAIVTTMSLLTVLAYAHDKRQ
FT                   AIRGGWRIPESRLHLLELFGGWPGALVARHWLRHKTQKGSYRRVFWFIVLLHLTLWGLW
FT                   LGRPLWQTI"
     gtgatctggc tcgccctgct tcccctgctg tggaccgcct ggctcggcct ggccgatgcc        60
     aactggtggc cgctcgccat cgtcaccacc atgagcctgc tgacggtgct ggcctacgcc       120
     cacgacaagc gccaggccat tcgcggtggc tggcgcatcc ccgaatcccg gctccacctg       180
     ctggagctgt tcggcggctg gccaggtgcc ctggtggccc gccactggtt gcgtcacaag       240
     acccagaagg ggagctatcg cagggtgttc tggttcatcg tgctgctgca cctcaccctg       300
     tgggggctct ggctcggccg cccgctctgg cagacgatct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page