(data stored in ACNUC7421 zone)

EMBL: CP000462.PE578

CP000462.PE578       Location/Qualifiers
FT   CDS_pept        complement(639766..640356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0602"
FT                   /product="maltose O-acetyltransferase"
FT                   /EC_number="2.3.1.79"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36537"
FT                   /db_xref="GOA:A0KFV9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV9"
FT                   /protein_id="ABK36537.1"
FT                   /translation="MASDWDKVLAGGALDSQSEEIANDRIRGQALLAQLNASPAGDEAL
FT                   RQRLCGELFGHCPDSCWISTPFTCEFGRNIHIGEKTFFNFNITILDVGEVHIGSHVLLA
FT                   PNVQIYTATHTMDYLERRNWTAYNKPVRIGDDCWIGGGAIICPGVTIGPRSIIGAGAVI
FT                   TRDIPADSVAVGNPARVIRSLSPDAPRGWELAL"
     atggcaagcg attgggacaa ggtactggcg ggcggcgccc tggacagcca gagcgaggag        60
     atagcgaacg accggatccg tggtcaggcg ctgctggcac aactcaacgc ctccccggcc       120
     ggtgacgaag ccctgcgcca gcgcctgtgc ggcgagctgt tcggccactg ccccgactcc       180
     tgctggatca gcactccctt cacctgcgaa ttcggccgca acatccacat cggcgaaaag       240
     accttcttca acttcaacat caccattctc gacgtgggcg aggtgcacat cggcagccat       300
     gtgctgctgg cccccaacgt gcagatctac accgccaccc acaccatgga ctatctggag       360
     cgacgcaact ggaccgccta caacaagccg gtgcggatcg gcgatgactg ctggattggc       420
     ggcggcgcca tcatctgccc cggcgtcacc atagggccgc gctccatcat aggtgccggc       480
     gccgtgatca cccgcgacat tccggccgac tcggtggcgg tgggcaaccc ggcgcgcgtg       540
     atccgcagcc tgagcccgga cgccccccgt ggctgggagc tggccctgtg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page