(data stored in ACNUC7421 zone)

EMBL: CP000462.PE581

CP000462.PE581       Location/Qualifiers
FT   CDS_pept        642967..643542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06821"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38512"
FT                   /db_xref="GOA:A0KFW2"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW2"
FT                   /protein_id="ABK38512.1"
FT                   /translation="MNKILLVPGLHNSGPDHWQSRWHQYFPHWQRMVGLPWDRPDLTVW
FT                   SAKLASKLRSRRGRAHLVAHSFGALAAITAARQQPDKVASLFIVAPADPARFGLPDELL
FT                   AGSLKVSAQLVASRNDPWMSFERAEYWSRQWQVPLFDAGEVGHINAQSGHGEWNQGLNL
FT                   LGTLYRRAEMVVEPTPAVWERRAALSFR"
     atgaacaaga tcctcctggt tcccggtctg cacaacagtg ggccggatca ctggcaaagc        60
     cgctggcacc aatacttccc ccactggcag cggatggtgg gcctgccgtg ggatcggccg       120
     gacctcacgg tctggagcgc caagctggcg agcaagctgc gcagccggcg cggccgggct       180
     cacctggtgg ctcactcctt cggcgcgctg gcggccatca cggcggcacg ccagcagccc       240
     gacaaggtgg cctcgctgtt catcgtggcc ccggcggatc cggcccgctt cggcttgcca       300
     gacgagctgc tggcaggatc gctcaaggtg tcggcccagc tggttgccag ccgcaacgat       360
     ccctggatga gctttgagcg ggccgagtac tggagccgcc agtggcaggt gccgctgttc       420
     gatgccggcg aggtgggcca catcaatgcc cagtccggcc acggcgagtg gaaccagggg       480
     ctcaacctgc tcggcaccct ctatcggcgg gccgagatgg tggtggagcc gacgccggcg       540
     gtgtgggagc gacgggcggc cttgagtttt cgctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page