(data stored in ACNUC7421 zone)

EMBL: CP000462.PE586

CP000462.PE586       Location/Qualifiers
FT   CDS_pept        complement(647841..649325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0610"
FT                   /product="chitin binding protein"
FT                   /note="identified by match to protein family HMM PF03067"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37291"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR041029"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW7"
FT                   /protein_id="ABK37291.1"
FT                   /translation="MLRGTPPANLTAHICRTEECMAAKIQLNHVAATLALLVSGSVLAH
FT                   GYISQPESRNYLCKTGGNSQCGAVQWEPQSVEGPSGFPQAGPPDGQIASAGSASWRELN
FT                   AQTSDRWTRREVQAGPFAISWTFTANHVTRNWRYYLTKQDWNPNQPLTRAAFELTPFCV
FT                   VDGNMTQPPKQVTHQCNLPQRTGYQVILGVWEVGDTSNSFYNVIDANFKGGTQPPLAWS
FT                   QGGTIYPSTELAVGDKARTLVFDANGVRPDLQTELTIASPEQGQKNNWAHALATKINAE
FT                   QSQIRAGQQSGEGQFNPIYGQNPVYFKAGSALERVEIQLEQQQPPVSNGVSVSGLESDY
FT                   LLDEGKLTLNFTVAAEGDLTVTNTLYDHGGAAKGQTSADIKDSTHSFTMPLTGLSAGHH
FT                   QLVIEGKPKAGGDAVQQTLDLMLKDPAAGGDYQFTFPDGLKSYTDGTKVLQPKNGKVYQ
FT                   CKPFPYRGWCSQWSASATQYEPGVGTNWQDAWIQVN"
     gtgcttcggg gaactccccc tgccaacttg actgcccaca tctgtcgaac agaggaatgt        60
     atggcagcaa aaatccaact caatcacgtc gctgcgacgc tggccctgct ggtcagtggc       120
     agcgtgctcg cccacggcta catcagccag ccggaatcgc gcaactacct gtgcaagacc       180
     ggcggcaaca gccagtgcgg cgcggtgcaa tgggagcccc agagcgtgga aggcccctcc       240
     ggcttcccgc aggccggccc gcccgatggt cagatcgcct cggctggcag tgccagctgg       300
     cgcgagctga acgcccagac cagcgaccgc tggacccgcc gcgaggtaca ggccggcccc       360
     ttcgccatca gctggacctt caccgccaac cacgtcaccc gcaactggcg ctactacctc       420
     accaagcagg actggaaccc gaatcagccg ctgacccgcg ccgccttcga gctcaccccc       480
     ttctgcgtgg tggacggcaa catgacccag ccgcccaagc aggtcaccca ccagtgcaac       540
     ctaccccagc gcaccggcta tcaggtgatc ctgggggtgt gggaagtggg ggacaccagc       600
     aacagcttct ataacgtgat cgacgccaac ttcaagggcg gcacccagcc gccgctggcc       660
     tggagccagg gcggcaccat ctatccttcc accgagctgg cggtcggcga caaggccaga       720
     accctggtgt tcgacgccaa cggcgtgcgc cccgatctgc agaccgagct gaccatcgcc       780
     agcccggagc agggccagaa gaacaactgg gcccacgccc tggcgaccaa gatcaatgca       840
     gagcagagcc agatccgcgc cggccagcag agcggcgaag gccagttcaa ccctatctac       900
     ggccagaacc cggtctactt caaggcgggc agcgccctgg agcgagtcga gatccagctc       960
     gaacaacagc agccgccggt gagcaacggt gtcagcgtga gcggcctgga gagcgactac      1020
     ctgctcgacg agggcaagct taccctcaac tttaccgtgg ccgccgaggg cgatctgacc      1080
     gtcaccaaca ccctgtatga tcacggtggg gccgccaagg ggcagaccag cgccgacatc      1140
     aaggacagca cccacagctt caccatgccg ctgaccgggc tcagcgccgg tcaccaccag      1200
     ctggtgatcg agggcaaacc caaggccggt ggcgatgcgg tgcagcagac cctggatctg      1260
     atgctcaagg atccggccgc cggcggtgac taccagttca ccttcccgga cgggctcaag      1320
     tcctacaccg acggtaccaa ggtgctgcag cccaagaacg gcaaggtcta tcagtgcaag      1380
     cccttcccct atcgcggctg gtgcagtcag tggtcggcca gtgccaccca gtatgaaccc      1440
     ggggtcggca ccaattggca ggatgcctgg atccaggtga actga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page