(data stored in ACNUC7421 zone)

EMBL: CP000462.PE587

CP000462.PE587       Location/Qualifiers
FT   CDS_pept        complement(649679..651376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0611"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39381"
FT                   /db_xref="GOA:A0KFW8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW8"
FT                   /protein_id="ABK39381.1"
FT                   /translation="MFKLGDIAVSRKLMLLLSLALIGFIALLLISASALHRNLMSEREA
FT                   RLQAVLDLAMSRIQTLAATLPAPQAQAEAKAMLNSMRFDGDNYLFVLDENRRMVVHPVR
FT                   PELVGQQMGESGTATAGVHWQQMVDLGKGGHSGRLEYKWISPSGEAAQKMSLVAGYQPW
FT                   GWILGSGVLLQDIQATIWSQYQLMGGATLLVTLLMGLLGFAISRSIVNPLAEINRAMQQ
FT                   VAAGDLVVSIPVHGQDELGAVASCTNQGLNAIRRALLEASQGARNVADAALRIAASAEQ
FT                   TNQAVNSQRDQLAQLATAMNEMSATISDVAGHAENTARDTQDATSEAGLGNRDVHASVH
FT                   GIQALATEVEQATLQVNQLKEGVMQISEVTAVISAISEQTNLLALNAAIEAARAGEQGR
FT                   GFAVVADEVRQLASRTRQSTEEIQSTIAQLQQRAVTAASAMDASRKLAESSVSQSEKAG
FT                   QDLSLIVNHIQHVSDMATQIATAAEQQSMVAEDMNRNVSGINDSALEMSQSASQLARES
FT                   ELLAGLSRSLDERLAVFKLGSAIDQQLEQRLAPLHRQVSPAERPRVRH"
     atgttcaagc tcggtgatat tgccgtgagc cgcaaactga tgctgttgct ctcactggcg        60
     ctgatcggtt tcatcgcact actgctcatc tcggccagtg ccctgcatcg caacctgatg       120
     agtgaacggg aagccaggct gcaggccgta ctggatctgg ccatgagccg gatccagacg       180
     ctggcggcca ccctgcctgc cccccaggcc caggccgaag ccaaggccat gctcaacagc       240
     atgcgctttg acggcgacaa ctacctgttc gtgctggatg agaaccgccg gatggtggtg       300
     caccccgtca gacccgagct ggtcggccag cagatgggcg agagcggcac cgctaccgcc       360
     ggcgtccact ggcagcagat ggtggatctc ggcaaggggg gccacagcgg ccggctggaa       420
     tacaagtgga tctccccctc cggcgaggcg gcccagaaga tgtcgctggt ggccggttat       480
     cagccctggg gctggatcct cggatccggc gtgctgctgc aggacatcca ggccaccatc       540
     tggtcccagt atcagctgat ggggggcgcc accttgctgg tgaccctgct gatgggactg       600
     ctgggctttg ccatcagccg ctccatcgtc aatccgctgg ccgagatcaa ccgggccatg       660
     cagcaggtgg ccgccggcga tctggtggtg agcatcccgg tgcacggcca ggatgagctg       720
     ggcgccgtcg ccagctgcac caaccaggga ctcaacgcca ttcgccgcgc cctgctggag       780
     gcgagccagg gggcccgcaa cgtggcggat gccgccctgc gcatcgccgc ctccgccgag       840
     cagaccaacc aggcggtcaa cagccagcgg gatcagctgg cccagctcgc caccgccatg       900
     aacgagatga gcgccaccat ctccgacgtg gcgggtcacg ccgagaacac cgcccgcgac       960
     acccaggacg ccaccagcga ggccggcctc ggcaaccgtg acgtgcacgc cagcgtgcac      1020
     ggcatccagg cgctggccac cgaggtggag caggccaccc tgcaggtcaa ccagcttaaa      1080
     gagggggtga tgcagataag cgaggtgacg gcggtcatca gcgccatctc ggagcagacc      1140
     aacctgctgg ccctcaacgc cgccatcgag gcggcccgcg ccggcgaaca gggccgtggg      1200
     tttgccgtgg tggccgacga agtgcgccag ctggccagtc gcacccgcca gtccaccgag      1260
     gagatccaga gcaccatagc ccagctgcaa cagcgggcgg tgaccgccgc cagcgccatg      1320
     gacgccagcc gcaagctggc ggagagcagc gtcagccagt cggagaaggc gggccaggat      1380
     ctctccctca tcgtcaacca tatccagcac gtcagcgaca tggcgaccca gatagcgacc      1440
     gcggcggagc agcagagcat ggtggcggag gacatgaacc gcaacgtcag cggcatcaac      1500
     gactcggcgc tggagatgtc ccagtccgcc tcccagctgg cccgggagag cgaactgctg      1560
     gccggacttt cgcgcagcct ggacgagcgg ctggcggtat tcaaactcgg cagcgccatc      1620
     gaccagcagc tggagcagcg gctcgcccct ctgcaccggc aggtgagccc ggctgaacgc      1680
     ccccgcgttc gccactga                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page