(data stored in ACNUC7421 zone)

EMBL: CP000462.PE588

CP000462.PE588       Location/Qualifiers
FT   CDS_pept        651672..653519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0612"
FT                   /product="oligoendopeptidase F"
FT                   /note="identified by match to protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37892"
FT                   /db_xref="GOA:A0KFW9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW9"
FT                   /protein_id="ABK37892.1"
FT                   /translation="MSSIARNYLNQLNADYLQVHRRKEDLFWSTYMGTSDDQAGFTAAE
FT                   QAYKAFCADPARLPVLRQMQAQAEETELKRGLGGWIAFFECNVIEDPQAAALMDELVAA
FT                   EAALFARRRELKLTLLDEQGRQVAGSLPAASTALAASSDEAVRQSALAMFHTLEQWVVD
FT                   NGYLAIVALRNRFARAMGYRDYFDYKVHKNEQMSPAQLFAILDDFIAGTEQRLHQSLAE
FT                   LKAAKGEAALLPHNLRYSVSGDVTRQLDPYVPFSRALQDWVESFRRLGIQYRGATLTLD
FT                   LLTREGKYENGFCHGPVPSFWQEGEWVPAVVNFTSLANPAQVGSGWSGLNTLFHEGGHA
FT                   AHFANVTGNAPCFSQEFPPTSMAYAETQSMFCDSLLDDADWLKRYARNAAGEPIPDALI
FT                   KAMIEARQPFRAFNERQIALVAYFERDLYAMDEAERTPAAVLVLARRWERKILGGESPR
FT                   PLLAIPHLLNQESACAYHGYLLALMAVEQTRAYFLKRDGYLTDNPRIGPDLAAHYWGPG
FT                   NGMTHDETLQSLTGKGFSAGPLARACNQSVAEAWQQAEACMAAARQRPPVGEGEPLNAR
FT                   IRVVHGDQLIADNSGSEAAMLADFECWIRDHYQETVTSH"
     atgagttcca ttgccaggaa ttatctcaac cagctcaacg ccgactacct gcaggtacac        60
     aggcgcaagg aggatctgtt ctggtccacc tacatgggca ccagcgacga tcaggccggc       120
     ttcaccgccg ccgagcaggc ttacaaggcg ttctgcgccg atccggcgcg cctgccggtg       180
     ctgcggcaga tgcaggccca ggccgaggag accgagctca agcgcggtct ggggggctgg       240
     atcgccttct tcgagtgcaa cgtcatcgag gatcctcagg ccgccgccct gatggacgaa       300
     ctggtggccg ccgaggcggc gctgtttgcc cgtcgccggg agctgaagct gaccttgctg       360
     gacgagcagg gccggcaggt ggccggcagc ctgcccgccg ccagcacggc gctggccgcc       420
     agcagcgacg aggcggtgcg ccaaagcgcg ctcgccatgt tccacaccct ggagcagtgg       480
     gtggtggaca acggctatct ggccatcgtc gcgctgcgca accgcttcgc ccgcgccatg       540
     ggttatcgcg actacttcga ctacaaggtg cacaagaacg agcagatgag cccggcgcag       600
     ctgttcgcca ttctcgacga cttcatcgcc ggcaccgagc agcggctgca ccagagcctg       660
     gccgagctga aagcggccaa gggggaggcg gccctgctgc cccacaacct gcgctacagc       720
     gtgagtggcg acgtgacccg ccagctcgac ccttacgtgc ccttctcgcg ggcgctgcag       780
     gactgggtcg agagctttcg ccggctcggc atccagtacc gcggtgccac cctcaccctg       840
     gatctgctga cccgggaggg gaaatacgag aacggcttct gccacggccc ggtgccgagc       900
     ttctggcagg agggggagtg ggtgccggcg gtggtcaact tcaccagcct ggccaacccg       960
     gcccaggtgg gcagcggctg gagcgggctc aacaccctgt tccacgaggg cggccacgcg      1020
     gcgcactttg ccaatgtcac cggcaacgcc ccctgcttct cccaggagtt cccgcccacc      1080
     tccatggcct acgccgagac ccagtcgatg ttctgcgaca gcctgctgga cgatgcggac      1140
     tggctcaagc gctacgccag aaacgcggca ggggagccga tccccgatgc gctgatcaag      1200
     gcgatgatcg aggcgcgcca gccgtttcgc gccttcaatg agcgccagat cgcgctggtg      1260
     gcctacttcg agcgggatct ctacgccatg gacgaggccg agcgtacccc ggccgcagtg      1320
     ctggtactgg cccgccgctg ggagcgcaag atcctggggg gggagagccc gcgcccgctg      1380
     ctggccatcc cgcacctgct taatcaagag tcggcctgcg cctatcacgg ctacctgctg      1440
     gcgctgatgg cggtggagca gacccgcgcc tacttcctca aacgcgacgg ctacctcacc      1500
     gacaacccgc gcatcgggcc ggatctggcc gcccactact ggggaccggg caacggcatg      1560
     acccatgacg agacgctgca aagcctgacc ggcaagggct tcagcgccgg cccgctggcc      1620
     cgggcctgca accagagcgt ggccgaggcg tggcagcagg cagaggcctg catggcggcg      1680
     gcccgccagc gtccgccggt cggtgagggt gagccgctca atgcccgcat ccgggtggtt      1740
     cacggcgacc agcttatcgc cgacaatagc ggctctgaag cggccatgct ggccgacttc      1800
     gagtgctgga tccgcgacca ctaccaggag acggtgacca gccactga                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page