(data stored in ACNUC7421 zone)

EMBL: CP000462.PE591

CP000462.PE591       Location/Qualifiers
FT   CDS_pept        656878..657588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38761"
FT                   /db_xref="GOA:A0KFX2"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX2"
FT                   /protein_id="ABK38761.1"
FT                   /translation="MNAIHCFIRIVFDWSISMKRAKWKPWLGLGALLAGVIGWYLWPQG
FT                   VAPGQAAGDEERAADSGPLAELTPLAAMPAPALKPAPIAAPAKPDRLREDGSQQLETPW
FT                   QAAEVDADFPLAEPGDAVEQPQPIALQGSDLERAQVGDSVALPMPDGSTLQARVTKVEL
FT                   QRGGERNWQGEIRVDGDSYPVNFTVGKQATFGFIGTPQGSYSVETLGGKGWVYKNPPLD
FT                   LGHGGDDALIPTHQ"
     ttgaacgcaa ttcattgttt tataaggatt gtttttgact ggagtatcag tatgaagaga        60
     gcgaaatgga agccttggct ggggttgggc gccctcttgg ccggggtgat cggctggtac       120
     ctgtggccgc aaggggtggc gcccggtcag gcggcagggg atgaggagcg cgcggcggat       180
     agcggcccgc tggcggagct cacgccgctc gccgccatgc ccgcccccgc gctcaagccg       240
     gcgccgatcg cagcccccgc caagccggat cggctgcggg aagatggcag ccagcagctg       300
     gagaccccct ggcaggcggc cgaggtggat gcggactttc cgctggcgga gcccggcgat       360
     gcggtcgagc aacctcagcc gatcgccctg cagggcagcg atctggagcg ggcccaggtg       420
     ggtgacagcg tggccctgcc aatgccggac ggcagcaccc tgcaggccag ggtgaccaag       480
     gttgaactgc agcgaggcgg ggagcgcaac tggcaggggg aaattcgggt cgacggtgac       540
     agctatccgg tcaatttcac cgtcggcaag caagcgactt tcgggttcat cggcacgccg       600
     caaggcagtt actccgtcga gaccctggga ggcaagggct gggtttacaa gaacccgcca       660
     ctggatctgg gtcatggcgg cgatgacgcc ctgatcccga ctcaccaata a                711
//

If you have problems or comments...

PBIL Back to PBIL home page